BLASTX nr result
ID: Coptis24_contig00030224
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00030224 (283 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003630258.1| Cysteine desulfurase [Medicago truncatula] g... 65 4e-09 ref|XP_002310507.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 ref|XP_003630257.1| hypothetical protein MTR_8g093550 [Medicago ... 58 7e-07 ref|XP_002328318.1| predicted protein [Populus trichocarpa] gi|2... 58 9e-07 ref|XP_003524304.1| PREDICTED: probable cysteine desulfurase-lik... 57 1e-06 >ref|XP_003630258.1| Cysteine desulfurase [Medicago truncatula] gi|355524280|gb|AET04734.1| Cysteine desulfurase [Medicago truncatula] Length = 645 Score = 65.5 bits (158), Expect = 4e-09 Identities = 33/69 (47%), Positives = 47/69 (68%) Frame = -2 Query: 207 ETHQQVVTTYDFNLGVVCFKMQKGGIDLQSELSIHEKCSWLQSQQIGNYIEFDTPFGKRR 28 +T+ ++ T++DF FK + +DL S+ EK WL+SQ IGNY +FD+PFG+R+ Sbjct: 32 KTNNKLETSHDFCYHPESFK-KLVEMDLPCNESVEEKLCWLRSQIIGNYAKFDSPFGRRK 90 Query: 27 LTYADHTAS 1 L YADHTAS Sbjct: 91 LVYADHTAS 99 >ref|XP_002310507.1| predicted protein [Populus trichocarpa] gi|222853410|gb|EEE90957.1| predicted protein [Populus trichocarpa] Length = 488 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -2 Query: 102 EKCSWLQSQQIGNYIEFDTPFGKRRLTYADHTAS 1 +K +WL+SQ +GN IEFD+PFGKRRLTYADHTAS Sbjct: 1 KKLAWLRSQIVGNDIEFDSPFGKRRLTYADHTAS 34 >ref|XP_003630257.1| hypothetical protein MTR_8g093550 [Medicago truncatula] gi|355524279|gb|AET04733.1| hypothetical protein MTR_8g093550 [Medicago truncatula] Length = 635 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = -2 Query: 135 GIDLQSELSIHEKCSWLQSQQIGNYIEFDTPFGKRRLTYADHTAS 1 GI L S+ EK WL+SQ IGN +EF++PFG R+L Y+DHTAS Sbjct: 55 GISLPCNESVEEKLCWLRSQIIGNDVEFNSPFGTRKLVYSDHTAS 99 >ref|XP_002328318.1| predicted protein [Populus trichocarpa] gi|222838033|gb|EEE76398.1| predicted protein [Populus trichocarpa] Length = 491 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -2 Query: 102 EKCSWLQSQQIGNYIEFDTPFGKRRLTYADHTAS 1 +K +WL+SQ IG+ +EFD+PFGKRRLTYADHTAS Sbjct: 1 KKLAWLRSQIIGDDVEFDSPFGKRRLTYADHTAS 34 >ref|XP_003524304.1| PREDICTED: probable cysteine desulfurase-like [Glycine max] Length = 609 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -2 Query: 111 SIHEKCSWLQSQQIGNYIEFDTPFGKRRLTYADHTAS 1 S+ EK WL+SQ IGN EFD+PFGKR++ YADHTAS Sbjct: 47 SVEEKLHWLRSQIIGNDAEFDSPFGKRKVVYADHTAS 83