BLASTX nr result
ID: Coptis24_contig00029966
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00029966 (397 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263191.1| PREDICTED: uncharacterized protein LOC100261... 81 5e-25 emb|CBI23968.3| unnamed protein product [Vitis vinifera] 81 5e-25 ref|XP_002330640.1| predicted protein [Populus trichocarpa] gi|2... 81 3e-24 ref|XP_002305794.1| predicted protein [Populus trichocarpa] gi|2... 79 3e-23 ref|XP_003545987.1| PREDICTED: uncharacterized protein LOC100797... 77 7e-23 >ref|XP_002263191.1| PREDICTED: uncharacterized protein LOC100261530 [Vitis vinifera] Length = 309 Score = 80.9 bits (198), Expect(2) = 5e-25 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = +2 Query: 2 EVFVGKAERLRTLIKIMCSAAKTCMREKKMHMGPWRKQKYMQAK 133 EVFVGK ERL TL+KI+C AAK CM+EKKMHMGPWRK +YMQAK Sbjct: 217 EVFVGKVERLHTLVKILCMAAKKCMKEKKMHMGPWRKHRYMQAK 260 Score = 58.5 bits (140), Expect(2) = 5e-25 Identities = 26/46 (56%), Positives = 36/46 (78%) Frame = +3 Query: 210 TCKRTMPTTTFSEGLTSRLQRPKASLLTFDLLEKLPSLHCTAVEVL 347 TC R+ T++ G + RL +PKAS+LT DL+EKLP++HCTAVEV+ Sbjct: 264 TCVRSTSTSSLLSGDSGRLPKPKASMLTVDLMEKLPNMHCTAVEVV 309 >emb|CBI23968.3| unnamed protein product [Vitis vinifera] Length = 275 Score = 80.9 bits (198), Expect(2) = 5e-25 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = +2 Query: 2 EVFVGKAERLRTLIKIMCSAAKTCMREKKMHMGPWRKQKYMQAK 133 EVFVGK ERL TL+KI+C AAK CM+EKKMHMGPWRK +YMQAK Sbjct: 183 EVFVGKVERLHTLVKILCMAAKKCMKEKKMHMGPWRKHRYMQAK 226 Score = 58.5 bits (140), Expect(2) = 5e-25 Identities = 26/46 (56%), Positives = 36/46 (78%) Frame = +3 Query: 210 TCKRTMPTTTFSEGLTSRLQRPKASLLTFDLLEKLPSLHCTAVEVL 347 TC R+ T++ G + RL +PKAS+LT DL+EKLP++HCTAVEV+ Sbjct: 230 TCVRSTSTSSLLSGDSGRLPKPKASMLTVDLMEKLPNMHCTAVEVV 275 >ref|XP_002330640.1| predicted protein [Populus trichocarpa] gi|222872244|gb|EEF09375.1| predicted protein [Populus trichocarpa] Length = 296 Score = 81.3 bits (199), Expect(2) = 3e-24 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = +2 Query: 2 EVFVGKAERLRTLIKIMCSAAKTCMREKKMHMGPWRKQKYMQAK 133 EVFVGKAERL LIKI+CSAAK CM+EKKMH+GPWRK KYMQ+K Sbjct: 205 EVFVGKAERLTALIKILCSAAKKCMKEKKMHLGPWRKHKYMQSK 248 Score = 55.5 bits (132), Expect(2) = 3e-24 Identities = 27/46 (58%), Positives = 33/46 (71%) Frame = +3 Query: 210 TCKRTMPTTTFSEGLTSRLQRPKASLLTFDLLEKLPSLHCTAVEVL 347 TC+RT P G + R +P+AS+LT+DLLE LP LHCTAVEVL Sbjct: 252 TCERTTPAP-LPGGFSDRTAKPRASMLTYDLLETLPVLHCTAVEVL 296 >ref|XP_002305794.1| predicted protein [Populus trichocarpa] gi|222848758|gb|EEE86305.1| predicted protein [Populus trichocarpa] Length = 306 Score = 78.6 bits (192), Expect(2) = 3e-23 Identities = 33/44 (75%), Positives = 40/44 (90%) Frame = +2 Query: 2 EVFVGKAERLRTLIKIMCSAAKTCMREKKMHMGPWRKQKYMQAK 133 EVFVGK ERL +++KI+C AAK CM+EKKMH+GPWRKQ+YMQAK Sbjct: 213 EVFVGKVERLNSVVKILCLAAKKCMKEKKMHLGPWRKQRYMQAK 256 Score = 54.7 bits (130), Expect(2) = 3e-23 Identities = 26/46 (56%), Positives = 32/46 (69%) Frame = +3 Query: 210 TCKRTMPTTTFSEGLTSRLQRPKASLLTFDLLEKLPSLHCTAVEVL 347 TC+R+ FS G + RL RPKAS+LT DL E LP +HCTAV V+ Sbjct: 261 TCERSTSMPPFSMGSSGRLPRPKASMLTVDLKEMLPDVHCTAVAVV 306 >ref|XP_003545987.1| PREDICTED: uncharacterized protein LOC100797510 [Glycine max] Length = 300 Score = 77.4 bits (189), Expect(2) = 7e-23 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = +2 Query: 2 EVFVGKAERLRTLIKIMCSAAKTCMREKKMHMGPWRKQKYMQAK 133 EVFVGK ERL LIKI+C AK CM+EKKMHMGPWRK +YMQAK Sbjct: 203 EVFVGKVERLSNLIKILCMGAKRCMKEKKMHMGPWRKHRYMQAK 246 Score = 54.7 bits (130), Expect(2) = 7e-23 Identities = 27/52 (51%), Positives = 35/52 (67%), Gaps = 5/52 (9%) Frame = +3 Query: 207 GTCKRTMPTTTFSEGLTSRL-----QRPKASLLTFDLLEKLPSLHCTAVEVL 347 G C+R T + S G + R+ RPKAS+LT DLLEKLP++HC AVEV+ Sbjct: 249 GPCERNTSTASLSVGYSERILPMAKPRPKASMLTVDLLEKLPNMHCNAVEVV 300