BLASTX nr result
ID: Coptis24_contig00029952
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00029952 (377 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002331487.1| predicted protein [Populus trichocarpa] gi|2... 72 5e-11 ref|XP_002517091.1| pentatricopeptide repeat-containing protein,... 56 3e-06 >ref|XP_002331487.1| predicted protein [Populus trichocarpa] gi|222873565|gb|EEF10696.1| predicted protein [Populus trichocarpa] Length = 606 Score = 72.0 bits (175), Expect = 5e-11 Identities = 46/135 (34%), Positives = 71/135 (52%), Gaps = 27/135 (20%) Frame = +3 Query: 51 TPSLKLTIYPLHLKMS------HFKQIQAVIIRTCLIPHT-------------------- 152 +P+ + +P+ L M KQIQA + +T LI HT Sbjct: 43 SPTNTIITHPILLAMESCTSMLQLKQIQAHMTKTALISHTFPVSRVLAFCALSDSGDINH 102 Query: 153 TNLLSITSQN-NLYIYNTIVKHYSKSKQSKVSIFLFREMVRKHLEMNKQTFVFTIKACEL 329 +LL QN N YI+NT+++ YSK+K + F +MV+K +EM+ ++FVF +KACE Sbjct: 103 AHLLFSQLQNPNTYIWNTMIRGYSKAKMGQTGFLFFCQMVQKGVEMDCRSFVFALKACEQ 162 Query: 330 FKGGVIVNEEIHCIV 374 F GV+ + +HC+V Sbjct: 163 FL-GVLEGKSVHCVV 176 >ref|XP_002517091.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543726|gb|EEF45254.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 606 Score = 55.8 bits (133), Expect = 3e-06 Identities = 36/115 (31%), Positives = 57/115 (49%), Gaps = 21/115 (18%) Frame = +3 Query: 93 MSHFKQIQAVIIRTCLIPHTTNLLSITS---------------------QNNLYIYNTIV 209 M KQIQA +I T LI HT + + + N YI+NT++ Sbjct: 171 MIQLKQIQAHMIITGLITHTFPVSRVLAFCALADTGDIRHAHLLFNQIEYPNTYIWNTMI 230 Query: 210 KHYSKSKQSKVSIFLFREMVRKHLEMNKQTFVFTIKACELFKGGVIVNEEIHCIV 374 + +S +K + + F +MVR+ +EM+ ++FVF +KA E F + E IHC + Sbjct: 231 RGFSNAKMPVMGLSFFWQMVRERVEMDTRSFVFALKASEQFL-TALEGESIHCAI 284