BLASTX nr result
ID: Coptis24_contig00029296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00029296 (302 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_178260.1| pentatricopeptide repeat-containing protein [Ar... 146 2e-33 ref|XP_002280792.1| PREDICTED: pentatricopeptide repeat-containi... 145 3e-33 ref|XP_002876755.1| pentatricopeptide repeat-containing protein ... 141 5e-32 ref|NP_198857.2| pentatricopeptide repeat-containing protein [Ar... 119 2e-25 ref|XP_002870708.1| hypothetical protein ARALYDRAFT_493946 [Arab... 119 3e-25 >ref|NP_178260.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75216969|sp|Q9ZVF4.1|PP140_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g01510, mitochondrial; Flags: Precursor gi|3785980|gb|AAC67327.1| hypothetical protein [Arabidopsis thaliana] gi|330250369|gb|AEC05463.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 584 Score = 146 bits (368), Expect = 2e-33 Identities = 68/100 (68%), Positives = 80/100 (80%) Frame = -1 Query: 302 GLVNEGRGYFEYMVSAKNGNIQPRIEHYACMVDLLGRYGLLEEAYNFIKSMPMEPDSGVW 123 GLVNEG+ YF MV + + N++PR EHYACMVDLLGR GLLEEAY FIK MP+EPD+G+W Sbjct: 325 GLVNEGKRYFSLMVQSNDKNLEPRKEHYACMVDLLGRSGLLEEAYEFIKKMPVEPDTGIW 384 Query: 122 GALLGACTTHQNTELGQHVADILSNLAPETGSYRVLLSNI 3 GALLGAC H++ LGQ VAD+L AP+ GSY VLLSNI Sbjct: 385 GALLGACAVHRDMILGQKVADVLVETAPDIGSYHVLLSNI 424 >ref|XP_002280792.1| PREDICTED: pentatricopeptide repeat-containing protein At2g01510, mitochondrial [Vitis vinifera] gi|297737690|emb|CBI26891.3| unnamed protein product [Vitis vinifera] Length = 610 Score = 145 bits (367), Expect = 3e-33 Identities = 70/100 (70%), Positives = 78/100 (78%) Frame = -1 Query: 302 GLVNEGRGYFEYMVSAKNGNIQPRIEHYACMVDLLGRYGLLEEAYNFIKSMPMEPDSGVW 123 G VNEG YF +M + + NIQPR EHYACMVDLLGR G LEEAYNFIK MP+E D G+W Sbjct: 351 GRVNEGWQYFNFMAQSDDKNIQPRKEHYACMVDLLGRSGHLEEAYNFIKIMPIEADPGIW 410 Query: 122 GALLGACTTHQNTELGQHVADILSNLAPETGSYRVLLSNI 3 GALLGAC HQN +LGQHVAD+L LAPE SY VLLSN+ Sbjct: 411 GALLGACAIHQNIKLGQHVADLLFELAPEIASYHVLLSNM 450 >ref|XP_002876755.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297322593|gb|EFH53014.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 597 Score = 141 bits (356), Expect = 5e-32 Identities = 67/100 (67%), Positives = 78/100 (78%) Frame = -1 Query: 302 GLVNEGRGYFEYMVSAKNGNIQPRIEHYACMVDLLGRYGLLEEAYNFIKSMPMEPDSGVW 123 GLVNEG+ YF MV + N++PR EHYACMVDLLGR GLLEEAY FIK M +EPD+G+W Sbjct: 325 GLVNEGKRYFSLMVRLNDKNLEPRKEHYACMVDLLGRSGLLEEAYEFIKKMRVEPDTGIW 384 Query: 122 GALLGACTTHQNTELGQHVADILSNLAPETGSYRVLLSNI 3 GALLGAC H++ LGQ VAD+L AP+ GSY VLLSNI Sbjct: 385 GALLGACAVHRDMILGQKVADVLVETAPDIGSYHVLLSNI 424 >ref|NP_198857.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75171829|sp|Q9FND6.1|PP411_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g40410, mitochondrial; Flags: Precursor gi|10178153|dbj|BAB11598.1| selenium-binding protein-like [Arabidopsis thaliana] gi|17065126|gb|AAL32717.1| selenium-binding protein-like [Arabidopsis thaliana] gi|30725418|gb|AAP37731.1| At5g40410 [Arabidopsis thaliana] gi|332007162|gb|AED94545.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 608 Score = 119 bits (299), Expect = 2e-25 Identities = 59/100 (59%), Positives = 72/100 (72%) Frame = -1 Query: 302 GLVNEGRGYFEYMVSAKNGNIQPRIEHYACMVDLLGRYGLLEEAYNFIKSMPMEPDSGVW 123 GLV EG+ YFE M +K I PR++HY+CMVDLLGR GLL++AY IK MPMEP SGVW Sbjct: 350 GLVEEGKHYFETM--SKRYRIDPRLDHYSCMVDLLGRSGLLQDAYGLIKEMPMEPSSGVW 407 Query: 122 GALLGACTTHQNTELGQHVADILSNLAPETGSYRVLLSNI 3 GALLGAC +++T+LG A+ L L P G V+LSNI Sbjct: 408 GALLGACRVYKDTQLGTKAAERLFELEPRDGRNYVMLSNI 447 >ref|XP_002870708.1| hypothetical protein ARALYDRAFT_493946 [Arabidopsis lyrata subsp. lyrata] gi|297316544|gb|EFH46967.1| hypothetical protein ARALYDRAFT_493946 [Arabidopsis lyrata subsp. lyrata] Length = 1111 Score = 119 bits (297), Expect = 3e-25 Identities = 58/100 (58%), Positives = 72/100 (72%) Frame = -1 Query: 302 GLVNEGRGYFEYMVSAKNGNIQPRIEHYACMVDLLGRYGLLEEAYNFIKSMPMEPDSGVW 123 GLV EGR YFE M +K I+PR++HY+CMVDL+GR GLL++AY IK MPMEP SGVW Sbjct: 853 GLVEEGRYYFETM--SKRYRIEPRLDHYSCMVDLMGRSGLLQDAYGLIKEMPMEPSSGVW 910 Query: 122 GALLGACTTHQNTELGQHVADILSNLAPETGSYRVLLSNI 3 GALLGAC +++T+LG A L L P G ++LSNI Sbjct: 911 GALLGACRVYKDTQLGTKAAKRLFELEPRDGRNYIMLSNI 950 Score = 73.2 bits (178), Expect = 2e-11 Identities = 39/100 (39%), Positives = 58/100 (58%) Frame = -1 Query: 302 GLVNEGRGYFEYMVSAKNGNIQPRIEHYACMVDLLGRYGLLEEAYNFIKSMPMEPDSGVW 123 G V+EG+ +F+ M I+P+++HY C+VDL R G LE+A + I+ MPM+ + VW Sbjct: 363 GFVDEGQKHFDSM--RNEFGIEPQLDHYGCLVDLYARAGRLEDAVSIIQQMPMKAHAAVW 420 Query: 122 GALLGACTTHQNTELGQHVADILSNLAPETGSYRVLLSNI 3 +LL A ++N ELG + + L VLLSNI Sbjct: 421 SSLLHASRMYKNLELGVLASKKMLELETSNHGAYVLLSNI 460