BLASTX nr result
ID: Coptis24_contig00029108
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00029108 (204 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003591561.1| hypothetical protein MTR_1g088810 [Medicago ... 63 2e-08 >ref|XP_003591561.1| hypothetical protein MTR_1g088810 [Medicago truncatula] gi|355480609|gb|AES61812.1| hypothetical protein MTR_1g088810 [Medicago truncatula] Length = 444 Score = 63.2 bits (152), Expect = 2e-08 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -2 Query: 149 DSDRHFSESMVLASLSPPSLELVHSLGDPLLSRSS 45 DSDRHFSESMVLA L PPSLEL+HSLGDPLLSR S Sbjct: 149 DSDRHFSESMVLAFLFPPSLELIHSLGDPLLSRWS 183