BLASTX nr result
ID: Coptis24_contig00029040
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00029040 (677 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528482.1| conserved hypothetical protein [Ricinus comm... 59 1e-06 >ref|XP_002528482.1| conserved hypothetical protein [Ricinus communis] gi|223532091|gb|EEF33899.1| conserved hypothetical protein [Ricinus communis] Length = 92 Score = 58.5 bits (140), Expect = 1e-06 Identities = 35/81 (43%), Positives = 48/81 (59%), Gaps = 6/81 (7%) Frame = -1 Query: 311 SYVSLILIFMMVCTLFPHPSLAMRRL------REVETDSEEGSLKDVENMLLRGEVGHLP 150 S V IL+ + + L P P LA+R+L R + + E +KD ++ GE GH+ Sbjct: 5 SSVLSILLLLSLFHLHPLPCLALRKLEDAQVVRYISSSDLEIFMKDFQSF---GEGGHVH 61 Query: 149 RVKLHEVHSGPNPISNFFPQR 87 R +LHEVHSGPNPISN PQ+ Sbjct: 62 RKELHEVHSGPNPISNTIPQQ 82