BLASTX nr result
ID: Coptis24_contig00028457
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00028457 (325 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003550085.1| PREDICTED: L-ascorbate oxidase homolog isofo... 55 5e-06 ref|XP_003550084.1| PREDICTED: L-ascorbate oxidase homolog isofo... 55 5e-06 ref|XP_003517277.1| PREDICTED: L-ascorbate oxidase homolog [Glyc... 55 5e-06 ref|XP_003611825.1| L-ascorbate oxidase-like protein [Medicago t... 55 5e-06 emb|CAN72539.1| hypothetical protein VITISV_028750 [Vitis vinifera] 55 5e-06 >ref|XP_003550085.1| PREDICTED: L-ascorbate oxidase homolog isoform 2 [Glycine max] Length = 533 Score = 55.5 bits (132), Expect = 5e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +1 Query: 121 VYHNSWTAILVPLDNKGMWNLQSAIWPRQ 207 VY NSW+AILV LDNKGMWNL+SAIWP++ Sbjct: 466 VYPNSWSAILVSLDNKGMWNLRSAIWPQR 494 >ref|XP_003550084.1| PREDICTED: L-ascorbate oxidase homolog isoform 1 [Glycine max] Length = 544 Score = 55.5 bits (132), Expect = 5e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +1 Query: 121 VYHNSWTAILVPLDNKGMWNLQSAIWPRQ 207 VY NSW+AILV LDNKGMWNL+SAIWP++ Sbjct: 477 VYPNSWSAILVSLDNKGMWNLRSAIWPQR 505 >ref|XP_003517277.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max] Length = 540 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 3/45 (6%) Frame = +1 Query: 121 VYHNSWTAILVPLDNKGMWNLQSAIWPRQQVSLNF---VFGSQKS 246 VY SWT ILV LDN+GMWNL+SAIW RQ + F V+ +QKS Sbjct: 474 VYPKSWTTILVSLDNQGMWNLRSAIWERQYLGQQFYLRVWNAQKS 518 >ref|XP_003611825.1| L-ascorbate oxidase-like protein [Medicago truncatula] gi|355513160|gb|AES94783.1| L-ascorbate oxidase-like protein [Medicago truncatula] Length = 538 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = +1 Query: 121 VYHNSWTAILVPLDNKGMWNLQSAIWPRQ 207 VY NSWTAILV LDN+GMWNL+SAIW RQ Sbjct: 472 VYPNSWTAILVSLDNQGMWNLRSAIWERQ 500 >emb|CAN72539.1| hypothetical protein VITISV_028750 [Vitis vinifera] Length = 503 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/46 (54%), Positives = 33/46 (71%), Gaps = 1/46 (2%) Frame = +1 Query: 121 VYHNSWTAILVPLDNKGMWNLQSAIWPRQQVSLN-FVFGSQKSNEL 255 VY NSW+A+L LDNKGMWNL+SAIW RQ + ++ ++ NEL Sbjct: 456 VYPNSWSAVLASLDNKGMWNLRSAIWSRQYLGQQLYIKSMEQRNEL 501