BLASTX nr result
ID: Coptis24_contig00028312
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00028312 (257 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513660.1| conserved hypothetical protein [Ricinus comm... 55 6e-06 >ref|XP_002513660.1| conserved hypothetical protein [Ricinus communis] gi|223547568|gb|EEF49063.1| conserved hypothetical protein [Ricinus communis] Length = 965 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 2/52 (3%) Frame = +1 Query: 106 HKTVFYPFTTS--KTKSYPSVKVKAQLNFPLIPPQDHWGTFSVLFATAAFGI 255 ++ F P T S T +K+++QL FPLI P DHWGT++ LFAT AFGI Sbjct: 561 NEAAFSPSTISLNNTSLIRQIKLRSQLRFPLISPDDHWGTWTALFATGAFGI 612