BLASTX nr result
ID: Coptis24_contig00028235
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00028235 (289 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282549.1| PREDICTED: homocysteine S-methyltransferase ... 62 6e-08 ref|XP_002315941.1| homocysteine s-methyltransferase [Populus tr... 60 2e-07 ref|XP_002875290.1| ATHMT-1/HMT-1 [Arabidopsis lyrata subsp. lyr... 59 3e-07 ref|XP_002531629.1| 5-methyltetrahydrofolate:homocysteine methyl... 59 4e-07 ref|XP_004135092.1| PREDICTED: homocysteine S-methyltransferase ... 59 5e-07 >ref|XP_002282549.1| PREDICTED: homocysteine S-methyltransferase 1 [Vitis vinifera] gi|297737821|emb|CBI27022.3| unnamed protein product [Vitis vinifera] Length = 325 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 285 RWRDLGAKLIGGCCRTTPSTIQAISKVLKK 196 +WRDLGAKLIGGCCRTTPSTI+AISKVLK+ Sbjct: 294 KWRDLGAKLIGGCCRTTPSTIRAISKVLKE 323 >ref|XP_002315941.1| homocysteine s-methyltransferase [Populus trichocarpa] gi|222864981|gb|EEF02112.1| homocysteine s-methyltransferase [Populus trichocarpa] Length = 329 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -2 Query: 285 RWRDLGAKLIGGCCRTTPSTIQAISKVLK 199 RW DLGA LIGGCCRTTPSTIQAISKVLK Sbjct: 296 RWHDLGASLIGGCCRTTPSTIQAISKVLK 324 >ref|XP_002875290.1| ATHMT-1/HMT-1 [Arabidopsis lyrata subsp. lyrata] gi|297321128|gb|EFH51549.1| ATHMT-1/HMT-1 [Arabidopsis lyrata subsp. lyrata] Length = 326 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 285 RWRDLGAKLIGGCCRTTPSTIQAISKVLKK 196 +WRDLGAKLIGGCCRTTPSTI+AISK LK+ Sbjct: 296 KWRDLGAKLIGGCCRTTPSTIKAISKDLKR 325 >ref|XP_002531629.1| 5-methyltetrahydrofolate:homocysteine methyltransferase, putative [Ricinus communis] gi|223528747|gb|EEF30757.1| 5-methyltetrahydrofolate:homocysteine methyltransferase, putative [Ricinus communis] Length = 327 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 285 RWRDLGAKLIGGCCRTTPSTIQAISKVLKK 196 RW DLGA LIGGCCRTTPSTI+AISKVLK+ Sbjct: 296 RWHDLGANLIGGCCRTTPSTIRAISKVLKE 325 >ref|XP_004135092.1| PREDICTED: homocysteine S-methyltransferase 1-like [Cucumis sativus] gi|449493450|ref|XP_004159294.1| PREDICTED: homocysteine S-methyltransferase 1-like [Cucumis sativus] Length = 328 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -2 Query: 288 ARWRDLGAKLIGGCCRTTPSTIQAISKVLKKS 193 +RWR+LGA IGGCCRTTPSTI+A+SKVLK+S Sbjct: 295 SRWRNLGATFIGGCCRTTPSTIRAVSKVLKES 326