BLASTX nr result
ID: Coptis24_contig00028064
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00028064 (297 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273131.2| PREDICTED: rab proteins geranylgeranyltransf... 55 5e-06 emb|CAN62777.1| hypothetical protein VITISV_019372 [Vitis vinifera] 55 5e-06 >ref|XP_002273131.2| PREDICTED: rab proteins geranylgeranyltransferase component A 2-like [Vitis vinifera] gi|296088658|emb|CBI37649.3| unnamed protein product [Vitis vinifera] Length = 556 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -2 Query: 113 DDDVSYPSIEPSQFDLIVVGTGLPESVVAASSSANGK 3 D+ SYP IEP+ FDLIVVGTGLP+SV+AA++S+ GK Sbjct: 2 DETPSYPPIEPTDFDLIVVGTGLPQSVIAAAASSAGK 38 >emb|CAN62777.1| hypothetical protein VITISV_019372 [Vitis vinifera] Length = 812 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -2 Query: 113 DDDVSYPSIEPSQFDLIVVGTGLPESVVAASSSANGK 3 D+ SYP IEP+ FDLIVVGTGLP+SV+AA++S+ GK Sbjct: 2 DETPSYPPIEPTDFDLIVVGTGLPQSVIAAAASSAGK 38