BLASTX nr result
ID: Coptis24_contig00026045
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00026045 (402 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI34813.3| unnamed protein product [Vitis vinifera] 67 2e-09 ref|XP_002281296.1| PREDICTED: putative DNA-binding protein ESCA... 67 2e-09 ref|XP_002279636.1| PREDICTED: putative DNA-binding protein ESCA... 65 6e-09 ref|XP_002299584.1| predicted protein [Populus trichocarpa] gi|2... 63 3e-08 ref|XP_002303540.1| predicted protein [Populus trichocarpa] gi|2... 63 3e-08 >emb|CBI34813.3| unnamed protein product [Vitis vinifera] Length = 240 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -2 Query: 380 LMSDSNAPLFQGLPPNLLNSCQLPTEAYWATGRSPY 273 L++D NAPLF GLPPNLLNS QLP EAYWATGR PY Sbjct: 205 LLADPNAPLFHGLPPNLLNSIQLPAEAYWATGRPPY 240 >ref|XP_002281296.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Vitis vinifera] Length = 302 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -2 Query: 380 LMSDSNAPLFQGLPPNLLNSCQLPTEAYWATGRSPY 273 L++D NAPLF GLPPNLLNS QLP EAYWATGR PY Sbjct: 267 LLADPNAPLFHGLPPNLLNSIQLPAEAYWATGRPPY 302 >ref|XP_002279636.1| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera] gi|147867329|emb|CAN81187.1| hypothetical protein VITISV_029906 [Vitis vinifera] gi|296089162|emb|CBI38865.3| unnamed protein product [Vitis vinifera] Length = 300 Score = 65.1 bits (157), Expect = 6e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -2 Query: 380 LMSDSNAPLFQGLPPNLLNSCQLPTEAYWATGRSPY 273 L+ D NA LFQGLPPNLLNSCQLP EAYW T R PY Sbjct: 265 LLPDPNASLFQGLPPNLLNSCQLPAEAYWGTARPPY 300 >ref|XP_002299584.1| predicted protein [Populus trichocarpa] gi|222846842|gb|EEE84389.1| predicted protein [Populus trichocarpa] Length = 302 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -2 Query: 380 LMSDSNAPLFQGLPPNLLNSCQLPTEAYWATGRSPY 273 +M++ NA LF GLPPNLLNS QLP EAYWATGR PY Sbjct: 267 VMAEQNAQLFHGLPPNLLNSIQLPAEAYWATGRPPY 302 >ref|XP_002303540.1| predicted protein [Populus trichocarpa] gi|222840972|gb|EEE78519.1| predicted protein [Populus trichocarpa] Length = 303 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -2 Query: 380 LMSDSNAPLFQGLPPNLLNSCQLPTEAYWATGRSPY 273 +M++ NA LF GLPPNLLNS QLP EAYWATGR PY Sbjct: 268 VMAEQNAQLFHGLPPNLLNSIQLPAEAYWATGRPPY 303