BLASTX nr result
ID: Coptis24_contig00024793
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00024793 (269 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269182.1| PREDICTED: probable galacturonosyltransferas... 157 1e-36 gb|AFM77985.1| glycosyltransferase 8E [Populus tremula x Populus... 156 1e-36 gb|ACE97767.1| family 8 glycosyl transferase [Populus tremula] 156 1e-36 gb|ACE97751.1| family 8 glycosyl transferase [Populus tremula] g... 156 1e-36 ref|XP_004157857.1| PREDICTED: probable galacturonosyltransferas... 155 3e-36 >ref|XP_002269182.1| PREDICTED: probable galacturonosyltransferase-like 2-like [Vitis vinifera] Length = 351 Score = 157 bits (396), Expect = 1e-36 Identities = 73/89 (82%), Positives = 80/89 (89%) Frame = -1 Query: 269 LDSDLILVDDIAKLAATPLGNEDDESVVLAAPEYCNANFTTYFTPSFWSNPTLSLTFEGR 90 LDSDL+LVDDIAKL ATPLG+ VLAAPEYCNANFT+YFTP+FWSNP+LSLTF GR Sbjct: 171 LDSDLVLVDDIAKLVATPLGDHS----VLAAPEYCNANFTSYFTPTFWSNPSLSLTFAGR 226 Query: 89 KACYFNTGVMVIDLERWRAGDYTTKIIEW 3 ACYFNTGVMVIDL+RWRAGDYTTKI+EW Sbjct: 227 NACYFNTGVMVIDLQRWRAGDYTTKIVEW 255 >gb|AFM77985.1| glycosyltransferase 8E [Populus tremula x Populus alba] Length = 354 Score = 156 bits (395), Expect = 1e-36 Identities = 74/89 (83%), Positives = 77/89 (86%) Frame = -1 Query: 269 LDSDLILVDDIAKLAATPLGNEDDESVVLAAPEYCNANFTTYFTPSFWSNPTLSLTFEGR 90 LDSDL+LVDDIA LAATPLG VLAAPEYCNANFTTYFTP+FWSNP LSLTF GR Sbjct: 174 LDSDLVLVDDIASLAATPLGT----GTVLAAPEYCNANFTTYFTPTFWSNPMLSLTFSGR 229 Query: 89 KACYFNTGVMVIDLERWRAGDYTTKIIEW 3 ACYFNTGVMVIDLERWR GDYTTKI+EW Sbjct: 230 NACYFNTGVMVIDLERWREGDYTTKIVEW 258 >gb|ACE97767.1| family 8 glycosyl transferase [Populus tremula] Length = 227 Score = 156 bits (395), Expect = 1e-36 Identities = 74/89 (83%), Positives = 77/89 (86%) Frame = -1 Query: 269 LDSDLILVDDIAKLAATPLGNEDDESVVLAAPEYCNANFTTYFTPSFWSNPTLSLTFEGR 90 LDSDL+LVDDIA LAATPLG VLAAPEYCNANFTTYFTP+FWSNP LSLTF GR Sbjct: 78 LDSDLVLVDDIASLAATPLGT----GTVLAAPEYCNANFTTYFTPTFWSNPMLSLTFSGR 133 Query: 89 KACYFNTGVMVIDLERWRAGDYTTKIIEW 3 ACYFNTGVMVIDLERWR GDYTTKI+EW Sbjct: 134 NACYFNTGVMVIDLERWREGDYTTKIVEW 162 >gb|ACE97751.1| family 8 glycosyl transferase [Populus tremula] gi|190898478|gb|ACE97752.1| family 8 glycosyl transferase [Populus tremula] gi|190898480|gb|ACE97753.1| family 8 glycosyl transferase [Populus tremula] gi|190898482|gb|ACE97754.1| family 8 glycosyl transferase [Populus tremula] gi|190898486|gb|ACE97756.1| family 8 glycosyl transferase [Populus tremula] gi|190898488|gb|ACE97757.1| family 8 glycosyl transferase [Populus tremula] gi|190898490|gb|ACE97758.1| family 8 glycosyl transferase [Populus tremula] gi|190898492|gb|ACE97759.1| family 8 glycosyl transferase [Populus tremula] gi|190898494|gb|ACE97760.1| family 8 glycosyl transferase [Populus tremula] gi|190898496|gb|ACE97761.1| family 8 glycosyl transferase [Populus tremula] gi|190898498|gb|ACE97762.1| family 8 glycosyl transferase [Populus tremula] gi|190898502|gb|ACE97764.1| family 8 glycosyl transferase [Populus tremula] gi|190898504|gb|ACE97765.1| family 8 glycosyl transferase [Populus tremula] gi|190898506|gb|ACE97766.1| family 8 glycosyl transferase [Populus tremula] gi|190898510|gb|ACE97768.1| family 8 glycosyl transferase [Populus tremula] gi|190898512|gb|ACE97769.1| family 8 glycosyl transferase [Populus tremula] gi|190898514|gb|ACE97770.1| family 8 glycosyl transferase [Populus tremula] gi|190898516|gb|ACE97771.1| family 8 glycosyl transferase [Populus tremula] gi|190898518|gb|ACE97772.1| family 8 glycosyl transferase [Populus tremula] gi|190898520|gb|ACE97773.1| family 8 glycosyl transferase [Populus tremula] gi|190898522|gb|ACE97774.1| family 8 glycosyl transferase [Populus tremula] gi|190898524|gb|ACE97775.1| family 8 glycosyl transferase [Populus tremula] gi|190898528|gb|ACE97777.1| family 8 glycosyl transferase [Populus tremula] gi|190898534|gb|ACE97780.1| family 8 glycosyl transferase [Populus tremula] gi|190898536|gb|ACE97781.1| family 8 glycosyl transferase [Populus tremula] gi|190898538|gb|ACE97782.1| family 8 glycosyl transferase [Populus tremula] gi|190898540|gb|ACE97783.1| family 8 glycosyl transferase [Populus tremula] gi|190898542|gb|ACE97784.1| family 8 glycosyl transferase [Populus tremula] gi|190898544|gb|ACE97785.1| family 8 glycosyl transferase [Populus tremula] gi|190898546|gb|ACE97786.1| family 8 glycosyl transferase [Populus tremula] gi|190898548|gb|ACE97787.1| family 8 glycosyl transferase [Populus tremula] gi|190898550|gb|ACE97788.1| family 8 glycosyl transferase [Populus tremula] Length = 227 Score = 156 bits (395), Expect = 1e-36 Identities = 74/89 (83%), Positives = 77/89 (86%) Frame = -1 Query: 269 LDSDLILVDDIAKLAATPLGNEDDESVVLAAPEYCNANFTTYFTPSFWSNPTLSLTFEGR 90 LDSDL+LVDDIA LAATPLG VLAAPEYCNANFTTYFTP+FWSNP LSLTF GR Sbjct: 78 LDSDLVLVDDIASLAATPLGT----GTVLAAPEYCNANFTTYFTPTFWSNPMLSLTFSGR 133 Query: 89 KACYFNTGVMVIDLERWRAGDYTTKIIEW 3 ACYFNTGVMVIDLERWR GDYTTKI+EW Sbjct: 134 NACYFNTGVMVIDLERWREGDYTTKIVEW 162 >ref|XP_004157857.1| PREDICTED: probable galacturonosyltransferase-like 2-like, partial [Cucumis sativus] Length = 363 Score = 155 bits (392), Expect = 3e-36 Identities = 74/89 (83%), Positives = 79/89 (88%) Frame = -1 Query: 269 LDSDLILVDDIAKLAATPLGNEDDESVVLAAPEYCNANFTTYFTPSFWSNPTLSLTFEGR 90 LDSDLILVDDIAKLAATPLG E+ VLAAPEYCNAN T+YFTP+FWSNP+LS TF GR Sbjct: 183 LDSDLILVDDIAKLAATPLG----ETAVLAAPEYCNANLTSYFTPTFWSNPSLSFTFAGR 238 Query: 89 KACYFNTGVMVIDLERWRAGDYTTKIIEW 3 ACYFNTGVMVIDL+RWRAGDYT KIIEW Sbjct: 239 NACYFNTGVMVIDLQRWRAGDYTAKIIEW 267