BLASTX nr result
ID: Coptis24_contig00024713
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00024713 (314 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC61852.1| putative monosaccharide transporter 1 [Petunia x ... 86 4e-15 ref|XP_002516342.1| sugar transporter, putative [Ricinus communi... 80 2e-13 gb|AAY89232.1| hexose transporter 2 [Juglans regia] 79 5e-13 ref|XP_002525521.1| sugar transporter, putative [Ricinus communi... 79 5e-13 ref|XP_002525516.1| sugar transporter, putative [Ricinus communi... 79 5e-13 >gb|AAC61852.1| putative monosaccharide transporter 1 [Petunia x hybrida] Length = 510 Score = 85.5 bits (210), Expect = 4e-15 Identities = 35/48 (72%), Positives = 42/48 (87%) Frame = +3 Query: 3 LFFVFAVFVIAMTLFINFFLPETKGIPIDEMSKVWKNHWFWKRYFPSD 146 LFF FA FV+ MTLFI FFLPETKGIPI+E++++WKNHWFWK Y P+D Sbjct: 453 LFFFFAGFVVLMTLFIFFFLPETKGIPIEEVNRIWKNHWFWKSYVPND 500 >ref|XP_002516342.1| sugar transporter, putative [Ricinus communis] gi|223544508|gb|EEF46026.1| sugar transporter, putative [Ricinus communis] Length = 504 Score = 80.1 bits (196), Expect = 2e-13 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = +3 Query: 3 LFFVFAVFVIAMTLFINFFLPETKGIPIDEMSKVWKNHWFWKRYFPSD 146 LF FA FV MT+FI FFLPETK IPI+EMS++WKNHWFWKRY + Sbjct: 448 LFIFFAFFVAVMTIFIYFFLPETKNIPIEEMSQIWKNHWFWKRYMTEE 495 >gb|AAY89232.1| hexose transporter 2 [Juglans regia] Length = 508 Score = 78.6 bits (192), Expect = 5e-13 Identities = 34/55 (61%), Positives = 43/55 (78%) Frame = +3 Query: 3 LFFVFAVFVIAMTLFINFFLPETKGIPIDEMSKVWKNHWFWKRYFPSDGGNGRVD 167 LF FA FV+ MT+F+ FFLPETKGIPI+EM++VWK HW+W R F SD N +V+ Sbjct: 444 LFLFFAFFVMVMTVFVYFFLPETKGIPIEEMNRVWKTHWYWSR-FVSDDNNPKVE 497 >ref|XP_002525521.1| sugar transporter, putative [Ricinus communis] gi|223535200|gb|EEF36879.1| sugar transporter, putative [Ricinus communis] Length = 515 Score = 78.6 bits (192), Expect = 5e-13 Identities = 32/48 (66%), Positives = 38/48 (79%) Frame = +3 Query: 3 LFFVFAVFVIAMTLFINFFLPETKGIPIDEMSKVWKNHWFWKRYFPSD 146 LF FA FV MT+FI FFLPETK IPI+EMS++W+NHWFWKRY + Sbjct: 461 LFIFFAFFVAVMTVFIYFFLPETKNIPIEEMSQIWRNHWFWKRYMTEE 508 >ref|XP_002525516.1| sugar transporter, putative [Ricinus communis] gi|223535195|gb|EEF36874.1| sugar transporter, putative [Ricinus communis] Length = 461 Score = 78.6 bits (192), Expect = 5e-13 Identities = 32/48 (66%), Positives = 38/48 (79%) Frame = +3 Query: 3 LFFVFAVFVIAMTLFINFFLPETKGIPIDEMSKVWKNHWFWKRYFPSD 146 LF FA FV MT+FI FFLPETK IPI+EMS++W+NHWFWKRY + Sbjct: 405 LFIFFAFFVAVMTVFIYFFLPETKNIPIEEMSQIWRNHWFWKRYMTEE 452