BLASTX nr result
ID: Coptis24_contig00024491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00024491 (234 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003548120.1| PREDICTED: vacuolar iron transporter homolog... 60 2e-07 ref|XP_004139663.1| PREDICTED: vacuolar iron transporter homolog... 59 3e-07 ref|XP_003518603.1| PREDICTED: vacuolar iron transporter homolog... 59 5e-07 ref|XP_003592125.1| Nodulin-like protein [Medicago truncatula] g... 59 5e-07 gb|ACU21390.1| unknown [Glycine max] 58 7e-07 >ref|XP_003548120.1| PREDICTED: vacuolar iron transporter homolog 4-like [Glycine max] Length = 233 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +3 Query: 3 GKAPIGRSVTRVLIGGWFAMAITFGLTKLIGSSAL 107 GKAP+ RS RVL GGW AMAITFGLTKLIGSSAL Sbjct: 199 GKAPVLRSALRVLFGGWMAMAITFGLTKLIGSSAL 233 >ref|XP_004139663.1| PREDICTED: vacuolar iron transporter homolog 4-like [Cucumis sativus] gi|449525553|ref|XP_004169781.1| PREDICTED: vacuolar iron transporter homolog 4-like [Cucumis sativus] Length = 217 Score = 59.3 bits (142), Expect = 3e-07 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +3 Query: 3 GKAPIGRSVTRVLIGGWFAMAITFGLTKLIGSSAL 107 GKAP RSV RVLIGGW AMA+TFGLTKLIGSS L Sbjct: 183 GKAPTVRSVVRVLIGGWAAMAVTFGLTKLIGSSGL 217 >ref|XP_003518603.1| PREDICTED: vacuolar iron transporter homolog 4-like [Glycine max] Length = 239 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 3 GKAPIGRSVTRVLIGGWFAMAITFGLTKLIGSSAL 107 GKAP+ RS RVL GGW AMA+TFGLTKLIGSSAL Sbjct: 205 GKAPVLRSALRVLFGGWMAMAMTFGLTKLIGSSAL 239 >ref|XP_003592125.1| Nodulin-like protein [Medicago truncatula] gi|355481173|gb|AES62376.1| Nodulin-like protein [Medicago truncatula] Length = 217 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 3 GKAPIGRSVTRVLIGGWFAMAITFGLTKLIGSSAL 107 GKAP+ RS RVL+GGW AMAITFGLTKLIGSS L Sbjct: 183 GKAPVLRSCLRVLLGGWIAMAITFGLTKLIGSSGL 217 >gb|ACU21390.1| unknown [Glycine max] Length = 233 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 3 GKAPIGRSVTRVLIGGWFAMAITFGLTKLIGSSAL 107 G+AP+ RS RVL GGW AMAITFGLTKLIGSSAL Sbjct: 199 GEAPVLRSALRVLFGGWMAMAITFGLTKLIGSSAL 233