BLASTX nr result
ID: Coptis24_contig00024372
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00024372 (994 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABB55293.1| hypothetical protein 10.t00044 [Asparagus officin... 57 9e-06 >gb|ABB55293.1| hypothetical protein 10.t00044 [Asparagus officinalis] Length = 176 Score = 56.6 bits (135), Expect = 9e-06 Identities = 24/40 (60%), Positives = 32/40 (80%) Frame = +3 Query: 309 KRPMKNLKIDFNVDIPIYDGVVDADKLDNWIGRLETYYTI 428 K +NLKIDF V+I IYDG VD ++LD+WI R+ETY+T+ Sbjct: 101 KNSYQNLKIDFKVEILIYDGSVDVERLDDWIERMETYFTL 140