BLASTX nr result
ID: Coptis24_contig00024012
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00024012 (707 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511866.1| receptor protein kinase, putative [Ricinus c... 56 6e-06 >ref|XP_002511866.1| receptor protein kinase, putative [Ricinus communis] gi|223549046|gb|EEF50535.1| receptor protein kinase, putative [Ricinus communis] Length = 529 Score = 56.2 bits (134), Expect = 6e-06 Identities = 28/62 (45%), Positives = 44/62 (70%) Frame = -3 Query: 231 MNAQLEEVTNILISALDQNVVLQSQIVDSGRMVNDLEENIGTSVELLLNFKQEHDSLKLE 52 M + +EV L +ALDQ +LQSQI ++ +MV +LE+ I ++VELL N+K+E + L++E Sbjct: 381 MKNERDEVMEKLCTALDQKKLLQSQIAEADQMVKELEQKIISAVELLQNYKKEREELQME 440 Query: 51 RD 46 D Sbjct: 441 LD 442