BLASTX nr result
ID: Coptis24_contig00023978
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00023978 (210 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526758.1| Disease resistance protein RGA2, putative [R... 55 5e-06 >ref|XP_002526758.1| Disease resistance protein RGA2, putative [Ricinus communis] gi|223533885|gb|EEF35612.1| Disease resistance protein RGA2, putative [Ricinus communis] Length = 1100 Score = 55.5 bits (132), Expect = 5e-06 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 4/69 (5%) Frame = -2 Query: 197 NLVVIGLIQCRNCQNLPALGQLPSLKEVHLEELDALQFIEGGSVVRRQRE----WFPSLK 30 +LV + + C NCQNLP L Q PSLK + L++L+ L++IE G R +FPSL+ Sbjct: 781 SLVELRIDNCINCQNLPPLDQFPSLKHLTLDKLNDLKYIESGITYDRAESGPALFFPSLE 840 Query: 29 KIFLFANPN 3 K++L PN Sbjct: 841 KLWLRNCPN 849