BLASTX nr result
ID: Coptis24_contig00023791
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00023791 (808 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN83877.1| hypothetical protein VITISV_014760 [Vitis vinifera] 62 1e-07 >emb|CAN83877.1| hypothetical protein VITISV_014760 [Vitis vinifera] Length = 707 Score = 62.0 bits (149), Expect = 1e-07 Identities = 38/90 (42%), Positives = 50/90 (55%), Gaps = 5/90 (5%) Frame = +3 Query: 99 SSLVYLIGRLSTHYFC-----RLLFGRSPFCTKLRTFGCVCYMNLGDYGTTRFVPRSI*Y 263 S++V+LI RL + LLFG+ P + RTFGC+C+ L DY + P+S Y Sbjct: 66 STVVFLINRLPSLSLAGKTPYELLFGKQPDYSMPRTFGCLCFPYLRDYSPNKLSPKSTPY 125 Query: 264 VFSGYSSHHK*HVSCFSLCLTCET*RVPVS 353 VF GYS+ HK CL C+T RV VS Sbjct: 126 VFLGYSTLHK-----GFQCLDCKTHRVYVS 150