BLASTX nr result
ID: Coptis24_contig00023684
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00023684 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004157408.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 97 2e-18 ref|XP_004141438.1| PREDICTED: pentatricopeptide repeat-containi... 97 2e-18 ref|XP_002516159.1| pentatricopeptide repeat-containing protein,... 96 3e-18 ref|XP_002281998.2| PREDICTED: pentatricopeptide repeat-containi... 93 3e-17 ref|XP_003523656.1| PREDICTED: pentatricopeptide repeat-containi... 93 3e-17 >ref|XP_004157408.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g33170-like [Cucumis sativus] Length = 1573 Score = 96.7 bits (239), Expect = 2e-18 Identities = 49/88 (55%), Positives = 63/88 (71%) Frame = +1 Query: 1 IFDGFCLFRGLRRCEELSPTRLTLAPVLKMALFSGCISISEAIHCYAAKVGLDFDVFISG 180 + +GF LF GL R S TRLTLAP+LK+ L SG + +SE +H YA K+G + D+F+SG Sbjct: 698 VLEGFRLF-GLLREFGFSITRLTLAPLLKLCLLSGFVQVSETVHGYAVKIGFELDLFVSG 756 Query: 181 ILVNIYTKVGWVEEARRLFDEMPEKDVV 264 LVNIY K G V +AR LFD+MPE+D V Sbjct: 757 ALVNIYCKYGLVGQARLLFDKMPERDAV 784 >ref|XP_004141438.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Cucumis sativus] Length = 1573 Score = 96.7 bits (239), Expect = 2e-18 Identities = 49/88 (55%), Positives = 63/88 (71%) Frame = +1 Query: 1 IFDGFCLFRGLRRCEELSPTRLTLAPVLKMALFSGCISISEAIHCYAAKVGLDFDVFISG 180 + +GF LF GL R S TRLTLAP+LK+ L SG + +SE +H YA K+G + D+F+SG Sbjct: 698 VLEGFRLF-GLLREFGFSITRLTLAPLLKLCLLSGFVQVSETVHGYAVKIGFELDLFVSG 756 Query: 181 ILVNIYTKVGWVEEARRLFDEMPEKDVV 264 LVNIY K G V +AR LFD+MPE+D V Sbjct: 757 ALVNIYCKYGLVGQARLLFDKMPERDAV 784 >ref|XP_002516159.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223544645|gb|EEF46161.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1439 Score = 95.9 bits (237), Expect = 3e-18 Identities = 49/88 (55%), Positives = 65/88 (73%) Frame = +1 Query: 1 IFDGFCLFRGLRRCEELSPTRLTLAPVLKMALFSGCISISEAIHCYAAKVGLDFDVFISG 180 + +GF +FR LR +S ++LTLAP+LK+ L SG + S+A+H YA K+GL+ DVF+SG Sbjct: 791 VVEGFHIFRLLRE-RFVSTSKLTLAPMLKLCLLSGYVCASQAVHGYAVKIGLELDVFVSG 849 Query: 181 ILVNIYTKVGWVEEARRLFDEMPEKDVV 264 LVNIY+K G V EAR LFD M E+DVV Sbjct: 850 ALVNIYSKFGLVREARGLFDIMQERDVV 877 >ref|XP_002281998.2| PREDICTED: pentatricopeptide repeat-containing protein At4g33170 [Vitis vinifera] Length = 1580 Score = 92.8 bits (229), Expect = 3e-17 Identities = 49/86 (56%), Positives = 63/86 (73%) Frame = +1 Query: 7 DGFCLFRGLRRCEELSPTRLTLAPVLKMALFSGCISISEAIHCYAAKVGLDFDVFISGIL 186 +G LFR L R S TR+TLAPVLK+ L SGC+ +E +H YA K+GL++DVF+SG L Sbjct: 710 EGLHLFR-LLRASLGSTTRMTLAPVLKLCLNSGCLWAAEGVHGYAIKIGLEWDVFVSGAL 768 Query: 187 VNIYTKVGWVEEARRLFDEMPEKDVV 264 VNIY+K G + +AR LFD M E+DVV Sbjct: 769 VNIYSKCGRMRDARLLFDWMRERDVV 794 >ref|XP_003523656.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Glycine max] Length = 1611 Score = 92.8 bits (229), Expect = 3e-17 Identities = 51/86 (59%), Positives = 60/86 (69%) Frame = +1 Query: 7 DGFCLFRGLRRCEELSPTRLTLAPVLKMALFSGCISISEAIHCYAAKVGLDFDVFISGIL 186 DGF LFR LRR +S TR TLAPV KM L S S SE++H YA K+GL +DVF++G L Sbjct: 743 DGFHLFRLLRR-SVVSTTRHTLAPVFKMCLLSASPSASESLHGYAVKIGLQWDVFVAGAL 801 Query: 187 VNIYTKVGWVEEARRLFDEMPEKDVV 264 VNIY K G + EAR LFD M +DVV Sbjct: 802 VNIYAKFGLIREARVLFDGMAVRDVV 827