BLASTX nr result
ID: Coptis24_contig00023633
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00023633 (290 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003325657.2| hypothetical protein PGTG_06859 [Puccinia gr... 58 9e-07 ref|XP_003328314.2| hypothetical protein PGTG_09608 [Puccinia gr... 57 2e-06 ref|XP_003337812.2| hypothetical protein PGTG_19411 [Puccinia gr... 57 2e-06 >ref|XP_003325657.2| hypothetical protein PGTG_06859 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] gi|375165868|gb|EFP81238.2| hypothetical protein PGTG_06859 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 401 Score = 57.8 bits (138), Expect = 9e-07 Identities = 34/99 (34%), Positives = 55/99 (55%), Gaps = 5/99 (5%) Frame = -1 Query: 287 LQLS*LSEARMTYQLQEKSAFSLDHCYVILKDNPKWSNVFEARSSRPTKGK--GRKNDGE 114 ++++ L+EA+ Y+ +S+F+LDHC+ ILKD PKW + +R KGK G Sbjct: 155 MKIAKLTEAKELYKATFESSFNLDHCWGILKDTPKWQATQQENEARNKKGKQSGAAPPSS 214 Query: 113 DSTSNSPSVGGVELEGSQEIERPKEM---ERPLGSKKAK 6 D S++P+ +E+E +E E + + R G K AK Sbjct: 215 DIPSSTPATSAIEVE-DEESEASRSVLGNSRSEGQKAAK 252 >ref|XP_003328314.2| hypothetical protein PGTG_09608 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] gi|375167630|gb|EFP83895.2| hypothetical protein PGTG_09608 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 397 Score = 57.0 bits (136), Expect = 2e-06 Identities = 34/94 (36%), Positives = 51/94 (54%), Gaps = 5/94 (5%) Frame = -1 Query: 272 LSEARMTYQLQEKSAFSLDHCYVILKDNPKWSNVFEARSSRPTKGK--GRKNDGEDSTSN 99 L+EA+ Y+ +S+F+LDHC+ ILKD PKW + +R KGK G D S+ Sbjct: 156 LTEAKELYKATFESSFNLDHCWGILKDTPKWQATQQENEARNKKGKQSGAAPPSSDIPSS 215 Query: 98 SPSVGGVELEGSQEIERPKEM---ERPLGSKKAK 6 +P+ +E+E +E E + + R G K AK Sbjct: 216 TPATSAIEVE-DEESEASRSVLGNSRSEGQKAAK 248 >ref|XP_003337812.2| hypothetical protein PGTG_19411 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] gi|375165069|gb|EFP93393.2| hypothetical protein PGTG_19411 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 383 Score = 57.0 bits (136), Expect = 2e-06 Identities = 34/94 (36%), Positives = 51/94 (54%), Gaps = 5/94 (5%) Frame = -1 Query: 272 LSEARMTYQLQEKSAFSLDHCYVILKDNPKWSNVFEARSSRPTKGK--GRKNDGEDSTSN 99 L+EA+ Y+ +S+F+LDHC+ ILKD PKW + +R KGK G D S+ Sbjct: 156 LTEAKELYKATFESSFNLDHCWGILKDTPKWQATQQENEARNKKGKQSGAAPPSSDIPSS 215 Query: 98 SPSVGGVELEGSQEIERPKEM---ERPLGSKKAK 6 +P+ +E+E +E E + + R G K AK Sbjct: 216 TPATSAIEVE-DEESEASRSVLGNSRSEGQKAAK 248