BLASTX nr result
ID: Coptis24_contig00023504
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00023504 (503 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276453.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 >ref|XP_002276453.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Vitis vinifera] gi|296084392|emb|CBI24780.3| unnamed protein product [Vitis vinifera] Length = 890 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 1 WKVLIEGLLKKGLVEECSKLVSIMEENGCKPNSHT 105 WKVLI+GLLK+ LV+ECS+L+ IMEE GC+PN T Sbjct: 845 WKVLIDGLLKRDLVDECSELIDIMEEKGCQPNPLT 879