BLASTX nr result
ID: Coptis24_contig00023385
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00023385 (422 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002336465.1| predicted protein [Populus trichocarpa] gi|2... 77 2e-12 ref|XP_003531881.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 76 3e-12 ref|XP_003621540.1| RING finger protein [Medicago truncatula] gi... 75 6e-12 gb|AFK37449.1| unknown [Lotus japonicus] 74 1e-11 ref|XP_004156171.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 74 2e-11 >ref|XP_002336465.1| predicted protein [Populus trichocarpa] gi|222835076|gb|EEE73525.1| predicted protein [Populus trichocarpa] Length = 201 Score = 76.6 bits (187), Expect = 2e-12 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = +2 Query: 5 ENPQIVPECKHHYHLGCILEWMERSNTCPVCNKAMIYEETS 127 ENP+IV +C HHYHL CI EWMERS TCPVC+K MI++ETS Sbjct: 161 ENPRIVTQCNHHYHLSCIYEWMERSQTCPVCSKVMIFDETS 201 >ref|XP_003531881.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Glycine max] Length = 227 Score = 75.9 bits (185), Expect = 3e-12 Identities = 28/42 (66%), Positives = 37/42 (88%) Frame = +2 Query: 2 EENPQIVPECKHHYHLGCILEWMERSNTCPVCNKAMIYEETS 127 EENP+IV +C HH+HLGCI EWMERS++CPVC K M+++ET+ Sbjct: 185 EENPKIVTKCSHHFHLGCIYEWMERSDSCPVCGKVMVFDETT 226 >ref|XP_003621540.1| RING finger protein [Medicago truncatula] gi|217073256|gb|ACJ84987.1| unknown [Medicago truncatula] gi|355496555|gb|AES77758.1| RING finger protein [Medicago truncatula] Length = 227 Score = 75.1 bits (183), Expect = 6e-12 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = +2 Query: 2 EENPQIVPECKHHYHLGCILEWMERSNTCPVCNKAMIYEET 124 EENP+IV +C HHYHLGCI EWMERS++CPVC K M+++E+ Sbjct: 186 EENPKIVTKCNHHYHLGCIYEWMERSDSCPVCGKVMLFDES 226 >gb|AFK37449.1| unknown [Lotus japonicus] Length = 229 Score = 73.9 bits (180), Expect = 1e-11 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = +2 Query: 2 EENPQIVPECKHHYHLGCILEWMERSNTCPVCNKAMIYEETS 127 EENP+I+ +C HHYHLGCI EWMERS++CPVC K M ++ET+ Sbjct: 188 EENPRIMTKCSHHYHLGCIYEWMERSDSCPVCGKVMDFDETT 229 >ref|XP_004156171.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Cucumis sativus] Length = 227 Score = 73.6 bits (179), Expect = 2e-11 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = +2 Query: 5 ENPQIVPECKHHYHLGCILEWMERSNTCPVCNKAMIYEETS 127 ENP+IV +C HH+HLGCI EWMERS+ CPVC KAM ++ET+ Sbjct: 187 ENPKIVTKCSHHFHLGCIYEWMERSDNCPVCGKAMAFDETT 227