BLASTX nr result
ID: Coptis24_contig00022184
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00022184 (325 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530316.1| zinc finger protein, putative [Ricinus commu... 86 4e-15 ref|XP_002327310.1| predicted protein [Populus trichocarpa] gi|2... 86 4e-15 ref|XP_002530314.1| zinc finger protein, putative [Ricinus commu... 84 2e-14 ref|XP_002326038.1| predicted protein [Populus trichocarpa] gi|2... 82 3e-14 gb|ACG44198.1| ubiquitin-protein ligase/ zinc ion binding protei... 77 2e-12 >ref|XP_002530316.1| zinc finger protein, putative [Ricinus communis] gi|223530172|gb|EEF32083.1| zinc finger protein, putative [Ricinus communis] Length = 255 Score = 85.5 bits (210), Expect = 4e-15 Identities = 42/106 (39%), Positives = 60/106 (56%), Gaps = 1/106 (0%) Frame = -1 Query: 322 QSFRSARVFDRWCDALCELAVLRMGFRGRSNCPYPDCSTVFVSECILKTFTL-CSRCKLS 146 +S S VFD+WCD LC+ V + R CPY DCS + ++EC K + C CK + Sbjct: 89 RSIISKPVFDKWCDLLCDSVVSGVE---RCYCPYRDCSALVLNECKDKLKKIKCPNCKKN 145 Query: 145 FCFRCKIPWKVGHICTVEDIETDNGDDILVVNLAVEKEWRKCPGCG 8 C+ CKIPW G+ C E + + +D+L+ L EK+W +C CG Sbjct: 146 LCYVCKIPWHAGYQCN-ESGQLRDRNDVLIGELIEEKKWTRCYNCG 190 >ref|XP_002327310.1| predicted protein [Populus trichocarpa] gi|222835680|gb|EEE74115.1| predicted protein [Populus trichocarpa] Length = 228 Score = 85.5 bits (210), Expect = 4e-15 Identities = 44/103 (42%), Positives = 57/103 (55%), Gaps = 2/103 (1%) Frame = -1 Query: 310 SARVFDRWCDALCELAVLRMGFRGRSNCPYPDCSTVFVSECI--LKTFTLCSRCKLSFCF 137 S +F++WCD LC+ VL CPY DCS + ++EC+ LK C CK +FCF Sbjct: 93 SKPIFEKWCDHLCDSTVLGSE---SCYCPYRDCSVLVLNECMDNLKKIK-CPNCKKNFCF 148 Query: 136 RCKIPWKVGHICTVEDIETDNGDDILVVNLAVEKEWRKCPGCG 8 CKIPW G+ C E + +DILV L EK W +C CG Sbjct: 149 LCKIPWHAGYRCN-ESRHLRDRNDILVGELIEEKRWTRCYNCG 190 >ref|XP_002530314.1| zinc finger protein, putative [Ricinus communis] gi|223530170|gb|EEF32081.1| zinc finger protein, putative [Ricinus communis] Length = 213 Score = 83.6 bits (205), Expect = 2e-14 Identities = 41/101 (40%), Positives = 57/101 (56%), Gaps = 3/101 (2%) Frame = -1 Query: 301 VFDRWCDALCELAVLRMGFRGRSNCPYPDCSTVFVSECI---LKTFTLCSRCKLSFCFRC 131 +FD+W D LCE+ VL R CPY +CS + ++EC +K T C CK +FCF C Sbjct: 76 IFDKWSDLLCEVRVLEWE---RCYCPYENCSALILNECRYHKVKKVT-CPNCKKNFCFNC 131 Query: 130 KIPWKVGHICTVEDIETDNGDDILVVNLAVEKEWRKCPGCG 8 KIPW G+ C E + +G+D+L L + W +C CG Sbjct: 132 KIPWHGGYWCR-ESRQLRDGNDVLAGELIENQRWTRCYNCG 171 >ref|XP_002326038.1| predicted protein [Populus trichocarpa] gi|222862913|gb|EEF00420.1| predicted protein [Populus trichocarpa] Length = 241 Score = 82.4 bits (202), Expect = 3e-14 Identities = 41/101 (40%), Positives = 56/101 (55%), Gaps = 1/101 (0%) Frame = -1 Query: 310 SARVFDRWCDALCELAVLRMGFRGRSNCPYPDCSTVFVSECILKTFTL-CSRCKLSFCFR 134 S +F++WCD LC+ VL CPY DCS + ++EC K + C CK +FCF Sbjct: 93 SKPIFEKWCDRLCDSMVLGSE---SCYCPYRDCSVLVLNECKDKLKKINCPNCKKNFCFL 149 Query: 133 CKIPWKVGHICTVEDIETDNGDDILVVNLAVEKEWRKCPGC 11 CKIPW G+ C+ E + +DIL L EK+W +C C Sbjct: 150 CKIPWHTGYRCS-ESRHLRDRNDILAGELIEEKKWTRCYNC 189 >gb|ACG44198.1| ubiquitin-protein ligase/ zinc ion binding protein [Zea mays] gi|413921940|gb|AFW61872.1| putative RING zinc finger domain superfamily protein [Zea mays] Length = 220 Score = 76.6 bits (187), Expect = 2e-12 Identities = 43/108 (39%), Positives = 59/108 (54%), Gaps = 9/108 (8%) Frame = -1 Query: 307 ARVFDRWCDALCELAVLRMGFRGRSNCPYPDCSTVFVS-----ECILKTFTLCSRCKLSF 143 + VF+RWC LCE L +G R R+ CP+PDCS + V+ EC+ T + C C+ F Sbjct: 80 SEVFERWCAKLCES--LFLGAR-RTYCPFPDCSEMMVADDDGEECV--TQSECHGCRRLF 134 Query: 142 CFRCKIPWKVGHICTVEDIETDNG----DDILVVNLAVEKEWRKCPGC 11 C RC +PW G C E G +D+L+V A E W++CP C Sbjct: 135 CARCAVPWHAGLTCE-EIARLGEGEREREDLLLVKAAREGSWKRCPRC 181