BLASTX nr result
ID: Coptis24_contig00022137
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00022137 (323 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282270.1| PREDICTED: uncharacterized protein LOC100249... 64 1e-08 gb|AFK48585.1| unknown [Lotus japonicus] 63 2e-08 ref|XP_002519498.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 ref|XP_002322889.1| predicted protein [Populus trichocarpa] gi|1... 60 2e-07 ref|XP_003542532.1| PREDICTED: uncharacterized protein LOC100799... 58 7e-07 >ref|XP_002282270.1| PREDICTED: uncharacterized protein LOC100249954 isoform 1 [Vitis vinifera] gi|359481400|ref|XP_003632615.1| PREDICTED: uncharacterized protein LOC100249954 isoform 2 [Vitis vinifera] gi|297741640|emb|CBI32772.3| unnamed protein product [Vitis vinifera] Length = 99 Score = 63.9 bits (154), Expect = 1e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 1 NQYNWHDRAMLFEQHHWKKALKKGQPYQFK 90 NQ+NWHD+AMLFEQHHWKKAL K QPY+FK Sbjct: 48 NQFNWHDKAMLFEQHHWKKALAKKQPYKFK 77 >gb|AFK48585.1| unknown [Lotus japonicus] Length = 99 Score = 63.2 bits (152), Expect = 2e-08 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +1 Query: 1 NQYNWHDRAMLFEQHHWKKALKKGQPYQFK 90 NQYNWHD+AMLFEQ+HWKKA+KK +PY+F+ Sbjct: 48 NQYNWHDKAMLFEQYHWKKAMKKNEPYEFQ 77 >ref|XP_002519498.1| conserved hypothetical protein [Ricinus communis] gi|223541361|gb|EEF42912.1| conserved hypothetical protein [Ricinus communis] Length = 98 Score = 60.8 bits (146), Expect = 1e-07 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = +1 Query: 1 NQYNWHDRAMLFEQHHWKKALKKGQPYQFK 90 NQ+NWHD+A LFEQ+HWKKA+KK +PY+FK Sbjct: 48 NQFNWHDKAFLFEQYHWKKAMKKNEPYKFK 77 >ref|XP_002322889.1| predicted protein [Populus trichocarpa] gi|118485830|gb|ABK94762.1| unknown [Populus trichocarpa] gi|222867519|gb|EEF04650.1| predicted protein [Populus trichocarpa] Length = 98 Score = 60.1 bits (144), Expect = 2e-07 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = +1 Query: 1 NQYNWHDRAMLFEQHHWKKALKKGQPYQFK 90 NQ+NWHD+A LFEQ+HWKKA+KK +PY+FK Sbjct: 48 NQFNWHDKAFLFEQYHWKKAMKKKEPYKFK 77 >ref|XP_003542532.1| PREDICTED: uncharacterized protein LOC100799068 [Glycine max] Length = 90 Score = 58.2 bits (139), Expect = 7e-07 Identities = 21/29 (72%), Positives = 27/29 (93%) Frame = +1 Query: 1 NQYNWHDRAMLFEQHHWKKALKKGQPYQF 87 NQ+NWHD+AML+EQ+HWK+A KK QPY+F Sbjct: 48 NQFNWHDKAMLYEQYHWKQARKKNQPYEF 76