BLASTX nr result
ID: Coptis24_contig00022110
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00022110 (314 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003626000.1| Pentatricopeptide repeat protein [Medicago t... 66 3e-09 ref|XP_004135421.1| PREDICTED: putative pentatricopeptide repeat... 54 1e-05 >ref|XP_003626000.1| Pentatricopeptide repeat protein [Medicago truncatula] gi|355501015|gb|AES82218.1| Pentatricopeptide repeat protein [Medicago truncatula] Length = 607 Score = 66.2 bits (160), Expect = 3e-09 Identities = 31/52 (59%), Positives = 37/52 (71%) Frame = +3 Query: 3 GLHSNLEFGLFAAEAMYKLEKDHPAMYSLLSKIHGHNGVWTRVIELRKMMKQ 158 GLHSNLE G +AAE + +LE HP YS+LSKI G GVW+ V ELR MK+ Sbjct: 448 GLHSNLELGEYAAERIRRLESSHPVSYSVLSKIQGEKGVWSSVNELRDTMKE 499 >ref|XP_004135421.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g68930-like [Cucumis sativus] gi|449493520|ref|XP_004159329.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g68930-like [Cucumis sativus] Length = 743 Score = 54.3 bits (129), Expect = 1e-05 Identities = 26/52 (50%), Positives = 36/52 (69%) Frame = +3 Query: 6 LHSNLEFGLFAAEAMYKLEKDHPAMYSLLSKIHGHNGVWTRVIELRKMMKQM 161 L+ NLE G +AAE+++KLE +PA Y LLS I+ G W V +LRK M++M Sbjct: 552 LNGNLEIGKWAAESLHKLEPQNPASYILLSSIYAAKGKWDDVAKLRKGMREM 603