BLASTX nr result
ID: Coptis24_contig00022051
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00022051 (268 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACP30565.1| disease resistance protein [Brassica rapa subsp. ... 55 6e-06 >gb|ACP30565.1| disease resistance protein [Brassica rapa subsp. pekinensis] Length = 1009 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/56 (39%), Positives = 40/56 (71%) Frame = +1 Query: 13 IQPIAREMVRECDNLPILVISLAHAMRGEGKIEVWELAMEELSFSLTKIRELGETV 180 ++PIA+E+ REC LP+ ++++ AMRG+ K+ +W+ A+EEL S+ ++ + E V Sbjct: 328 VRPIAKEVSRECGGLPLAIVTVGMAMRGKKKVNLWKHALEELKCSVPYVKSIEEKV 383