BLASTX nr result
ID: Coptis24_contig00022035
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00022035 (541 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004159450.1| PREDICTED: uncharacterized LOC101215032 [Cuc... 56 4e-06 ref|XP_004140930.1| PREDICTED: uncharacterized protein LOC101215... 56 4e-06 >ref|XP_004159450.1| PREDICTED: uncharacterized LOC101215032 [Cucumis sativus] Length = 729 Score = 55.8 bits (133), Expect = 4e-06 Identities = 22/44 (50%), Positives = 30/44 (68%) Frame = +3 Query: 405 PKGFDIGWDHAICIPGNKNETQYKYCNKILAGGGITRLKLHLGG 536 P+ D GW H I + G + + + KYCNK++ GGGI+RLK HL G Sbjct: 12 PRASDPGWAHGIMVNGGRQKIKCKYCNKVMLGGGISRLKQHLAG 55 >ref|XP_004140930.1| PREDICTED: uncharacterized protein LOC101215032 [Cucumis sativus] Length = 728 Score = 55.8 bits (133), Expect = 4e-06 Identities = 22/44 (50%), Positives = 30/44 (68%) Frame = +3 Query: 405 PKGFDIGWDHAICIPGNKNETQYKYCNKILAGGGITRLKLHLGG 536 P+ D GW H I + G + + + KYCNK++ GGGI+RLK HL G Sbjct: 12 PRASDPGWAHGIMVNGGRQKIKCKYCNKVMLGGGISRLKQHLAG 55