BLASTX nr result
ID: Coptis24_contig00021978
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00021978 (180 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003526724.1| PREDICTED: uncharacterized protein LOC100783... 74 9e-12 ref|NP_680215.1| plastid transcriptionally active7 [Arabidopsis ... 74 1e-11 ref|NP_001190379.1| plastid transcriptionally active7 [Arabidops... 74 1e-11 ref|XP_002872105.1| PDE225/PTAC7 [Arabidopsis lyrata subsp. lyra... 74 1e-11 dbj|BAD95132.1| hypothetical protein [Arabidopsis thaliana] 74 1e-11 >ref|XP_003526724.1| PREDICTED: uncharacterized protein LOC100783539 [Glycine max] Length = 162 Score = 74.3 bits (181), Expect = 9e-12 Identities = 35/46 (76%), Positives = 38/46 (82%), Gaps = 1/46 (2%) Frame = +1 Query: 1 RDEYES-KKAILHVLSNRVNDVGFSRPEAYMDPDPYKPGPSYLREE 135 RDEY KKAILHVLSNR+ND G RPEAY +PDP+KPGP YLREE Sbjct: 115 RDEYGGEKKAILHVLSNRMNDTGIYRPEAYYEPDPFKPGPHYLREE 160 >ref|NP_680215.1| plastid transcriptionally active7 [Arabidopsis thaliana] gi|17380656|gb|AAL36158.1| unknown protein [Arabidopsis thaliana] gi|21689803|gb|AAM67545.1| unknown protein [Arabidopsis thaliana] gi|332005904|gb|AED93287.1| plastid transcriptionally active7 [Arabidopsis thaliana] Length = 161 Score = 73.9 bits (180), Expect = 1e-11 Identities = 35/45 (77%), Positives = 38/45 (84%), Gaps = 1/45 (2%) Frame = +1 Query: 1 RDEYE-SKKAILHVLSNRVNDVGFSRPEAYMDPDPYKPGPSYLRE 132 RDEY SKKAI HVLSNRVND+GF RPEAY++ DPYKPGP YL E Sbjct: 114 RDEYGGSKKAIFHVLSNRVNDLGFDRPEAYVEADPYKPGPGYLLE 158 >ref|NP_001190379.1| plastid transcriptionally active7 [Arabidopsis thaliana] gi|332005905|gb|AED93288.1| plastid transcriptionally active7 [Arabidopsis thaliana] Length = 169 Score = 73.9 bits (180), Expect = 1e-11 Identities = 35/45 (77%), Positives = 38/45 (84%), Gaps = 1/45 (2%) Frame = +1 Query: 1 RDEYE-SKKAILHVLSNRVNDVGFSRPEAYMDPDPYKPGPSYLRE 132 RDEY SKKAI HVLSNRVND+GF RPEAY++ DPYKPGP YL E Sbjct: 122 RDEYGGSKKAIFHVLSNRVNDLGFDRPEAYVEADPYKPGPGYLLE 166 >ref|XP_002872105.1| PDE225/PTAC7 [Arabidopsis lyrata subsp. lyrata] gi|297317942|gb|EFH48364.1| PDE225/PTAC7 [Arabidopsis lyrata subsp. lyrata] Length = 161 Score = 73.9 bits (180), Expect = 1e-11 Identities = 35/45 (77%), Positives = 38/45 (84%), Gaps = 1/45 (2%) Frame = +1 Query: 1 RDEYE-SKKAILHVLSNRVNDVGFSRPEAYMDPDPYKPGPSYLRE 132 RDEY SKKAI HVLSNRVND+GF RPEAY++ DPYKPGP YL E Sbjct: 114 RDEYGGSKKAIFHVLSNRVNDLGFDRPEAYVEADPYKPGPGYLLE 158 >dbj|BAD95132.1| hypothetical protein [Arabidopsis thaliana] Length = 161 Score = 73.9 bits (180), Expect = 1e-11 Identities = 35/45 (77%), Positives = 38/45 (84%), Gaps = 1/45 (2%) Frame = +1 Query: 1 RDEYE-SKKAILHVLSNRVNDVGFSRPEAYMDPDPYKPGPSYLRE 132 RDEY SKKAI HVLSNRVND+GF RPEAY++ DPYKPGP YL E Sbjct: 114 RDEYGGSKKAIFHVLSNRVNDLGFDRPEAYVEADPYKPGPGYLLE 158