BLASTX nr result
ID: Coptis24_contig00021922
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00021922 (253 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEF32083.1| ent-kaurene synthase [Castanea mollissima] 55 8e-06 >gb|AEF32083.1| ent-kaurene synthase [Castanea mollissima] Length = 784 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/53 (54%), Positives = 38/53 (71%), Gaps = 1/53 (1%) Frame = +3 Query: 3 AVLELYRASHIAL-PDELFLEKLKSWSHQYLKQELSYGSMHAHRLRESISKEV 158 +VLEL+RAS I + PDE LEK W+ Q+L QELS GS+HA L + +S+EV Sbjct: 360 SVLELFRASQIIIHPDEFVLEKQNFWTSQFLIQELSNGSIHADGLNKYVSQEV 412