BLASTX nr result
ID: Coptis24_contig00021851
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00021851 (363 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527006.1| catalytic, putative [Ricinus communis] gi|22... 57 2e-06 >ref|XP_002527006.1| catalytic, putative [Ricinus communis] gi|223533641|gb|EEF35378.1| catalytic, putative [Ricinus communis] Length = 526 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/58 (48%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = -2 Query: 215 EFSIQKFRATCKLHFLSRWTCVYLTSLVFKDHKR--KVQFLTASAMSVFAILYAVKSK 48 EFS+QKFR TC+LHF +RW YLT K+ K + L A AM+ FA++Y+V+ K Sbjct: 465 EFSLQKFRRTCRLHFFARWVWAYLTGGFLTGCKKLNKPKLLIAGAMAGFAVVYSVRYK 522