BLASTX nr result
ID: Coptis24_contig00021845
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00021845 (490 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003610646.1| hypothetical protein MTR_5g005410 [Medicago ... 63 3e-08 >ref|XP_003610646.1| hypothetical protein MTR_5g005410 [Medicago truncatula] gi|355511981|gb|AES93604.1| hypothetical protein MTR_5g005410 [Medicago truncatula] Length = 389 Score = 62.8 bits (151), Expect = 3e-08 Identities = 33/61 (54%), Positives = 41/61 (67%) Frame = -3 Query: 341 GLFPPAISRPQLGVRLLGRIVSTDASFIMGLVRKRVEKTLRLMSLLAQLKDP*CELTLLR 162 GLFP I RP LGV+LLG +VS D FI GL KR + + LM LL +L+DP E+ LLR Sbjct: 68 GLFPVDIRRPTLGVKLLGGVVSRDKGFIEGLAIKRASRVVELMHLLPRLRDPQREIFLLR 127 Query: 161 A 159 + Sbjct: 128 S 128