BLASTX nr result
ID: Coptis24_contig00021826
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00021826 (216 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003534917.1| PREDICTED: putative pentatricopeptide repeat... 47 2e-06 emb|CAN75824.1| hypothetical protein VITISV_004157 [Vitis vinifera] 42 3e-06 ref|XP_003533332.1| PREDICTED: putative pentatricopeptide repeat... 45 5e-06 ref|XP_003548963.1| PREDICTED: pentatricopeptide repeat-containi... 45 5e-06 ref|XP_002275680.2| PREDICTED: pentatricopeptide repeat-containi... 44 6e-06 >ref|XP_003534917.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial-like [Glycine max] Length = 527 Score = 46.6 bits (109), Expect(2) = 2e-06 Identities = 22/48 (45%), Positives = 30/48 (62%) Frame = -1 Query: 150 SIAVLGNILKRGFQPNAFTFNALIKGMFLDGKPTPALELFNKMVANRY 7 S VLG ILK G+QPN T N L+KG+ L G+ +L +K+VA + Sbjct: 64 SFTVLGKILKLGYQPNTITLNTLMKGLCLKGEVKKSLHFHDKVVAQGF 111 Score = 29.6 bits (65), Expect(2) = 2e-06 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -3 Query: 214 SMYNAMGSAGVQPDIVTLSTLINC 143 S++ M G++PD+ TL+ LINC Sbjct: 31 SLFKQMQVKGIEPDLFTLNILINC 54 >emb|CAN75824.1| hypothetical protein VITISV_004157 [Vitis vinifera] Length = 1512 Score = 41.6 bits (96), Expect(2) = 3e-06 Identities = 19/49 (38%), Positives = 31/49 (63%) Frame = -1 Query: 168 LRFLH*SIAVLGNILKRGFQPNAFTFNALIKGMFLDGKPTPALELFNKM 22 LR + V G LKRGF+P+A T L+KG++++ A++LF++M Sbjct: 994 LRAVGCGFGVFGGFLKRGFEPDAVTVTTLVKGVWMENGIPDAVQLFDEM 1042 Score = 33.9 bits (76), Expect(2) = 3e-06 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = -3 Query: 211 MYNAMGSAGVQPDIVTLSTLINCC 140 MY + G+QPD+ TL+ LI+CC Sbjct: 968 MYRKINDVGIQPDLYTLNILIHCC 991 >ref|XP_003533332.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial-like [Glycine max] Length = 546 Score = 45.4 bits (106), Expect(2) = 5e-06 Identities = 21/43 (48%), Positives = 29/43 (67%) Frame = -1 Query: 144 AVLGNILKRGFQPNAFTFNALIKGMFLDGKPTPALELFNKMVA 16 +VL ILKRG+QP+ TF LIKG+ L G+ AL +K++A Sbjct: 115 SVLAKILKRGYQPHTITFTTLIKGLCLKGQVNKALHFHDKLLA 157 Score = 29.6 bits (65), Expect(2) = 5e-06 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -3 Query: 214 SMYNAMGSAGVQPDIVTLSTLINC 143 S+ + + G+QPD++TL+ LINC Sbjct: 80 SLSHRLELKGIQPDLITLNILINC 103 >ref|XP_003548963.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62670, mitochondrial-like [Glycine max] Length = 520 Score = 44.7 bits (104), Expect(2) = 5e-06 Identities = 21/48 (43%), Positives = 30/48 (62%) Frame = -1 Query: 150 SIAVLGNILKRGFQPNAFTFNALIKGMFLDGKPTPALELFNKMVANRY 7 S +VLG ILK G+QPN N L+KG+ L G+ +L +K+VA + Sbjct: 64 SFSVLGKILKLGYQPNTIILNTLMKGLCLKGEVKKSLHFHDKVVAQGF 111 Score = 30.4 bits (67), Expect(2) = 5e-06 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -3 Query: 214 SMYNAMGSAGVQPDIVTLSTLINC 143 S+ M + G+ PD+VTLS LINC Sbjct: 31 SLSKQMEAKGIVPDLVTLSILINC 54 >ref|XP_002275680.2| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Vitis vinifera] gi|297735515|emb|CBI17955.3| unnamed protein product [Vitis vinifera] Length = 627 Score = 43.9 bits (102), Expect(2) = 6e-06 Identities = 21/47 (44%), Positives = 29/47 (61%) Frame = -1 Query: 147 IAVLGNILKRGFQPNAFTFNALIKGMFLDGKPTPALELFNKMVANRY 7 +AVLG +L+RG PN TF +L+KG+ L + + A L KMV Y Sbjct: 147 LAVLGEMLRRGHSPNTVTFTSLVKGLCLGSRISEATGLLRKMVRMGY 193 Score = 30.8 bits (68), Expect(2) = 6e-06 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -3 Query: 214 SMYNAMGSAGVQPDIVTLSTLINC 143 S+Y M G+ PD +TL+ LINC Sbjct: 113 SLYKRMSLIGLAPDFITLNILINC 136