BLASTX nr result
ID: Coptis24_contig00021552
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00021552 (285 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACP30597.1| disease resistance protein [Brassica rapa subsp. ... 55 4e-06 >gb|ACP30597.1| disease resistance protein [Brassica rapa subsp. pekinensis] Length = 798 Score = 55.5 bits (132), Expect = 4e-06 Identities = 29/62 (46%), Positives = 39/62 (62%), Gaps = 1/62 (1%) Frame = +3 Query: 3 PYFWEWGYSRKISLIRNHIQ-ILEDIEFCCPYLSTLLLQDNPLSHISSSFFFTMPAIQVL 179 P +W R++SL N IQ I D+ CP L+TLLL+DN L +IS FF +MP + VL Sbjct: 502 PEVRDWNAVRRMSLAENEIQNIAGDVSPVCPNLTTLLLKDNKLVNISGDFFLSMPKLVVL 561 Query: 180 DM 185 D+ Sbjct: 562 DL 563