BLASTX nr result
ID: Coptis24_contig00021331
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00021331 (285 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF35950.1| metallothionein [Coptis japonica] 110 9e-23 gb|ABN46987.1| metallothionein-like protein 2a [Nelumbo nucifera] 81 1e-13 gb|AFP93964.1| metallothionein type 2 [Ilex paraguariensis] 75 5e-12 gb|ABR92329.1| putative metallothionin 2a [Salvia miltiorrhiza] 75 7e-12 emb|CAB77242.1| metallothionein-like protein type 2 [Persea amer... 74 1e-11 >dbj|BAF35950.1| metallothionein [Coptis japonica] Length = 81 Score = 110 bits (276), Expect = 9e-23 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -3 Query: 148 YPDLGYSGEGTSGETMIIGFAPEKNYFEGSEMSVGAENDGCQCGANCTC 2 YPDLGYSGEGTSGETMIIGFAPEKNYFEGSEMSVGAENDGCQCGANCTC Sbjct: 27 YPDLGYSGEGTSGETMIIGFAPEKNYFEGSEMSVGAENDGCQCGANCTC 75 >gb|ABN46987.1| metallothionein-like protein 2a [Nelumbo nucifera] Length = 80 Score = 80.9 bits (198), Expect = 1e-13 Identities = 32/49 (65%), Positives = 41/49 (83%) Frame = -3 Query: 148 YPDLGYSGEGTSGETMIIGFAPEKNYFEGSEMSVGAENDGCQCGANCTC 2 YPD +SGE + ET+++G AP+K YFEGSEMS GAEN+GC+CG+NCTC Sbjct: 26 YPDFSFSGERATTETIVVGVAPQKAYFEGSEMSFGAENEGCKCGSNCTC 74 >gb|AFP93964.1| metallothionein type 2 [Ilex paraguariensis] Length = 78 Score = 75.1 bits (183), Expect = 5e-12 Identities = 35/49 (71%), Positives = 40/49 (81%) Frame = -3 Query: 148 YPDLGYSGEGTSGETMIIGFAPEKNYFEGSEMSVGAENDGCQCGANCTC 2 YPDL YS E T+ ET+I+G AP+K YFEGSEM VGAEN GC+CG NCTC Sbjct: 26 YPDLSYS-ESTTTETLIVGVAPQKTYFEGSEMGVGAEN-GCKCGDNCTC 72 >gb|ABR92329.1| putative metallothionin 2a [Salvia miltiorrhiza] Length = 80 Score = 74.7 bits (182), Expect = 7e-12 Identities = 29/49 (59%), Positives = 38/49 (77%) Frame = -3 Query: 148 YPDLGYSGEGTSGETMIIGFAPEKNYFEGSEMSVGAENDGCQCGANCTC 2 YPDL YS + ET+++G AP+K YFEGSEM +G + +GC+CGANCTC Sbjct: 26 YPDLSYSEASGAAETLVLGVAPQKTYFEGSEMGMGEDENGCKCGANCTC 74 >emb|CAB77242.1| metallothionein-like protein type 2 [Persea americana] Length = 76 Score = 73.9 bits (180), Expect = 1e-11 Identities = 31/49 (63%), Positives = 40/49 (81%) Frame = -3 Query: 148 YPDLGYSGEGTSGETMIIGFAPEKNYFEGSEMSVGAENDGCQCGANCTC 2 YPDL SGE T+ ET+I+G AP+K +F+G+EM GAEN GC+CG+NCTC Sbjct: 23 YPDLSSSGESTTSETLIMGVAPQKRHFDGAEMEAGAEN-GCKCGSNCTC 70