BLASTX nr result
ID: Coptis24_contig00020589
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00020589 (294 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285331.1| PREDICTED: cytochrome c oxidase subunit 5b-2... 69 3e-10 gb|AFU52881.1| cytochrome C oxidase subunit Vb [Vitis vinifera] 69 4e-10 gb|AAC08397.1| cytochrome c oxidase subunit Vb precursor [Mesemb... 66 3e-09 ref|NP_001078161.1| cytochrome c oxidase subunit Vb [Arabidopsis... 64 1e-08 gb|AEQ61828.1| cytochrome c oxidase subunit Vb [Dimocarpus longan] 62 4e-08 >ref|XP_002285331.1| PREDICTED: cytochrome c oxidase subunit 5b-2, mitochondrial [Vitis vinifera] gi|297743391|emb|CBI36258.3| unnamed protein product [Vitis vinifera] Length = 176 Score = 69.3 bits (168), Expect = 3e-10 Identities = 46/93 (49%), Positives = 60/93 (64%), Gaps = 3/93 (3%) Frame = -2 Query: 275 MWRRFISNQVQTRTRSDLKHFNRSVSIAKHHILN--HQASSSPLYSPFLTTSSYAFSRQF 102 MWR +S Q+QT RS RS + + +++ SP +PF T+S FSRQF Sbjct: 1 MWRGRLSAQLQTLARS------RSAANLTRLVTGDINRSFISPSPAPFRRTASL-FSRQF 53 Query: 101 SSDS-DTGLSEGKKKVEDVMPIATGHEREELEA 6 S++S D +S+ KK+VEDVMPIATGHEREELEA Sbjct: 54 SAESADNAVSKEKKRVEDVMPIATGHEREELEA 86 >gb|AFU52881.1| cytochrome C oxidase subunit Vb [Vitis vinifera] Length = 176 Score = 68.9 bits (167), Expect = 4e-10 Identities = 45/93 (48%), Positives = 60/93 (64%), Gaps = 3/93 (3%) Frame = -2 Query: 275 MWRRFISNQVQTRTRSDLKHFNRSVSIAKHHILN--HQASSSPLYSPFLTTSSYAFSRQF 102 MWR +S Q+QT RS RS + + +++ SP +PF T+S FSRQF Sbjct: 1 MWRGRLSAQLQTLARS------RSAANLTRLVTGDINRSFISPSPAPFRRTASL-FSRQF 53 Query: 101 SSDS-DTGLSEGKKKVEDVMPIATGHEREELEA 6 S++S D +S+ KK++EDVMPIATGHEREELEA Sbjct: 54 SAESADNAVSKEKKRIEDVMPIATGHEREELEA 86 >gb|AAC08397.1| cytochrome c oxidase subunit Vb precursor [Mesembryanthemum crystallinum] Length = 109 Score = 66.2 bits (160), Expect = 3e-09 Identities = 42/91 (46%), Positives = 53/91 (58%) Frame = -2 Query: 275 MWRRFISNQVQTRTRSDLKHFNRSVSIAKHHILNHQASSSPLYSPFLTTSSYAFSRQFSS 96 MWRR + + ++T S S S + I++ ASS SP SS FSR F++ Sbjct: 1 MWRRLVLSNLKTLASS-------SSSSSSSSIVHRSASSIVRASPSFRPSSSIFSRHFAA 53 Query: 95 DSDTGLSEGKKKVEDVMPIATGHEREELEAE 3 SD +S K+ EDVMPIATGHEREELEAE Sbjct: 54 ASDNVVSS--KRPEDVMPIATGHEREELEAE 82 >ref|NP_001078161.1| cytochrome c oxidase subunit Vb [Arabidopsis thaliana] gi|332642186|gb|AEE75707.1| cytochrome c oxidase subunit Vb [Arabidopsis thaliana] Length = 175 Score = 63.9 bits (154), Expect = 1e-08 Identities = 40/92 (43%), Positives = 56/92 (60%), Gaps = 1/92 (1%) Frame = -2 Query: 275 MWRRFISNQVQTRTRSDLKHF-NRSVSIAKHHILNHQASSSPLYSPFLTTSSYAFSRQFS 99 MWRR +S+Q++T + RS++ + + A++ S SS+ R+FS Sbjct: 1 MWRRIVSSQLKTLAADVVAASPRRSIAATTRPVGFYLAANRSAIS----ASSFVIPRRFS 56 Query: 98 SDSDTGLSEGKKKVEDVMPIATGHEREELEAE 3 SDS+T + KKVEDVMPIATGHE+EELEAE Sbjct: 57 SDSETPAT---KKVEDVMPIATGHEKEELEAE 85 >gb|AEQ61828.1| cytochrome c oxidase subunit Vb [Dimocarpus longan] Length = 140 Score = 62.4 bits (150), Expect = 4e-08 Identities = 41/91 (45%), Positives = 50/91 (54%) Frame = -2 Query: 275 MWRRFISNQVQTRTRSDLKHFNRSVSIAKHHILNHQASSSPLYSPFLTTSSYAFSRQFSS 96 MWRR S+ ++ L H + SIA N +S PL++ +R SS Sbjct: 1 MWRRICSSHLKALA---LSHSRSASSIAVSAAANRSLASPPLFT----------ARLLSS 47 Query: 95 DSDTGLSEGKKKVEDVMPIATGHEREELEAE 3 DS T + KKKVEDVMPIATGHEREEL AE Sbjct: 48 DSGTSV---KKKVEDVMPIATGHEREELAAE 75