BLASTX nr result
ID: Coptis24_contig00020374
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00020374 (256 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN68458.1| hypothetical protein VITISV_031449 [Vitis vinifera] 84 2e-14 ref|XP_002515544.1| conserved hypothetical protein [Ricinus comm... 80 2e-13 ref|XP_002324850.1| predicted protein [Populus trichocarpa] gi|2... 78 7e-13 ref|XP_002513460.1| conserved hypothetical protein [Ricinus comm... 77 1e-12 ref|XP_002325303.1| predicted protein [Populus trichocarpa] gi|2... 75 4e-12 >emb|CAN68458.1| hypothetical protein VITISV_031449 [Vitis vinifera] Length = 439 Score = 83.6 bits (205), Expect = 2e-14 Identities = 38/80 (47%), Positives = 52/80 (65%) Frame = +2 Query: 2 EEVSEMFNKLGKGVITGSKPSHYYSLVQNVNGYCKEQWHVWNRILKRDYLDNPWTIISLG 181 E VS +F KLGK V+ S + +L ++VN Y K +WH+W L+RDY +NPW IIS Sbjct: 354 EGVSHLFKKLGKEVVFNSDKFQFSNLCRDVNKYHKTRWHIWRATLRRDYFNNPWAIISFI 413 Query: 182 AAVFLLVCTCVQAVCSIISV 241 AV LL T +Q VCS++S+ Sbjct: 414 GAVLLLFFTLIQTVCSLLSL 433 >ref|XP_002515544.1| conserved hypothetical protein [Ricinus communis] gi|223545488|gb|EEF46993.1| conserved hypothetical protein [Ricinus communis] Length = 439 Score = 80.1 bits (196), Expect = 2e-13 Identities = 38/83 (45%), Positives = 51/83 (61%) Frame = +2 Query: 5 EVSEMFNKLGKGVITGSKPSHYYSLVQNVNGYCKEQWHVWNRILKRDYLDNPWTIISLGA 184 E S +FN L K ++ S +Y L +++N +CK +WH W LK +Y + PWT IS+ A Sbjct: 355 EASTLFNNLAKEILYDSHVFYYSLLCEDLNTFCKVRWHRWKATLKHNYFNTPWTAISVIA 414 Query: 185 AVFLLVCTCVQAVCSIISVLPKK 253 V LLV T +QAVCSII V K Sbjct: 415 GVILLVLTFIQAVCSIIQVSGSK 437 >ref|XP_002324850.1| predicted protein [Populus trichocarpa] gi|222866284|gb|EEF03415.1| predicted protein [Populus trichocarpa] Length = 410 Score = 78.2 bits (191), Expect = 7e-13 Identities = 37/80 (46%), Positives = 51/80 (63%) Frame = +2 Query: 2 EEVSEMFNKLGKGVITGSKPSHYYSLVQNVNGYCKEQWHVWNRILKRDYLDNPWTIISLG 181 E +S +F+ L K ++ LV+ +N YC++ WH W LK+ Y +NPW+IIS Sbjct: 331 EGMSALFHGLVKETFVIVDHFYFSGLVEELNAYCRKPWHKWQATLKQHYFNNPWSIISFI 390 Query: 182 AAVFLLVCTCVQAVCSIISV 241 AAV LLV T +QAVCSI+SV Sbjct: 391 AAVILLVLTTIQAVCSILSV 410 >ref|XP_002513460.1| conserved hypothetical protein [Ricinus communis] gi|223547368|gb|EEF48863.1| conserved hypothetical protein [Ricinus communis] Length = 410 Score = 77.0 bits (188), Expect = 1e-12 Identities = 35/81 (43%), Positives = 51/81 (62%) Frame = +2 Query: 2 EEVSEMFNKLGKGVITGSKPSHYYSLVQNVNGYCKEQWHVWNRILKRDYLDNPWTIISLG 181 E VS +F KL + + ++ SLV+ +N YCK W+ W LK+DY + PW +IS+ Sbjct: 329 EGVSTLFQKLEQENLLIPDDFYFSSLVEELNSYCKNPWNKWKATLKQDYFNTPWAVISVI 388 Query: 182 AAVFLLVCTCVQAVCSIISVL 244 AA LL+ T +Q+VCSI+ VL Sbjct: 389 AAAILLILTVIQSVCSILQVL 409 >ref|XP_002325303.1| predicted protein [Populus trichocarpa] gi|222862178|gb|EEE99684.1| predicted protein [Populus trichocarpa] Length = 438 Score = 75.5 bits (184), Expect = 4e-12 Identities = 37/81 (45%), Positives = 48/81 (59%) Frame = +2 Query: 2 EEVSEMFNKLGKGVITGSKPSHYYSLVQNVNGYCKEQWHVWNRILKRDYLDNPWTIISLG 181 E V+ +F L K +Y LV+++N YC ++ H W LK+ Y DNPWTIISL Sbjct: 358 EAVASLFRNLSKENTLAIDTFYYSGLVEDLNKYCGKRRHKWKATLKQKYFDNPWTIISLV 417 Query: 182 AAVFLLVCTCVQAVCSIISVL 244 AA LL+ T Q VCSII V+ Sbjct: 418 AATVLLILTITQTVCSIIQVV 438