BLASTX nr result
ID: Coptis24_contig00020025
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00020025 (212 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003581576.1| PREDICTED: E3 ubiquitin-protein ligase UPL3-... 76 2e-12 ref|XP_002968883.1| ubiquitin-protein ligase, UPL3 [Selaginella ... 57 2e-06 ref|XP_002974090.1| ubiquitin-protein ligase, UPL3 [Selaginella ... 57 2e-06 >ref|XP_003581576.1| PREDICTED: E3 ubiquitin-protein ligase UPL3-like [Brachypodium distachyon] Length = 1860 Score = 76.3 bits (186), Expect = 2e-12 Identities = 48/103 (46%), Positives = 53/103 (51%), Gaps = 39/103 (37%) Frame = -2 Query: 193 LNCLEKTSEEYSTTCLRAVALMAVLSYLDFFSI--------------------------- 95 L L+K S+E+ T CLRA ALMAVLSYLDFFS Sbjct: 287 LQALKKISQEHPTACLRAGALMAVLSYLDFFSTGVQRVALSTAANICRKLPSDASDFVME 346 Query: 94 ------------DV*VLEHASVCLAQITEALASSPEKLDELCN 2 D VLEHASVCL +I+EA ASSPEKLDELCN Sbjct: 347 AVPLLTNLLNYHDTKVLEHASVCLTRISEAFASSPEKLDELCN 389 >ref|XP_002968883.1| ubiquitin-protein ligase, UPL3 [Selaginella moellendorffii] gi|300163388|gb|EFJ29999.1| ubiquitin-protein ligase, UPL3 [Selaginella moellendorffii] Length = 1827 Score = 57.0 bits (136), Expect = 2e-06 Identities = 37/103 (35%), Positives = 48/103 (46%), Gaps = 39/103 (37%) Frame = -2 Query: 193 LNCLEKTSEEYSTTCLRAVALMAVLSYLDFFSI--------------------------- 95 L LEK S E+ CLRA AL+AVLSYLDFFS Sbjct: 272 LQALEKISHEHPAACLRAGALVAVLSYLDFFSTGVQRVAVSTAANICRQLPSDGVNFVME 331 Query: 94 ------------DV*VLEHASVCLAQITEALASSPEKLDELCN 2 D V++HAS+CL +I ++ A+S EK+D LC+ Sbjct: 332 SVPILTNLLQYQDPKVVDHASLCLTRIADSFANSSEKIDVLCS 374 >ref|XP_002974090.1| ubiquitin-protein ligase, UPL3 [Selaginella moellendorffii] gi|300158422|gb|EFJ25045.1| ubiquitin-protein ligase, UPL3 [Selaginella moellendorffii] Length = 1827 Score = 57.0 bits (136), Expect = 2e-06 Identities = 37/103 (35%), Positives = 48/103 (46%), Gaps = 39/103 (37%) Frame = -2 Query: 193 LNCLEKTSEEYSTTCLRAVALMAVLSYLDFFSI--------------------------- 95 L LEK S E+ CLRA AL+AVLSYLDFFS Sbjct: 272 LQALEKISHEHPAACLRAGALVAVLSYLDFFSTGVQRVAVSTAANICRQLPSDGVNFVME 331 Query: 94 ------------DV*VLEHASVCLAQITEALASSPEKLDELCN 2 D V++HAS+CL +I ++ A+S EK+D LC+ Sbjct: 332 SVPILTNLLQYQDPKVVDHASLCLTRIADSFANSSEKIDVLCS 374