BLASTX nr result
ID: Coptis24_contig00019189
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00019189 (469 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518104.1| transcription factor, putative [Ricinus comm... 69 5e-10 ref|XP_002300173.1| predicted protein [Populus trichocarpa] gi|2... 67 2e-09 emb|CCA29095.1| putative MYB transcription factor [Rosa rugosa] ... 64 1e-08 gb|ABK94861.1| unknown [Populus trichocarpa] 64 1e-08 ref|XP_002268698.2| PREDICTED: uncharacterized protein LOC100250... 64 2e-08 >ref|XP_002518104.1| transcription factor, putative [Ricinus communis] gi|223542700|gb|EEF44237.1| transcription factor, putative [Ricinus communis] Length = 303 Score = 68.6 bits (166), Expect = 5e-10 Identities = 33/48 (68%), Positives = 41/48 (85%), Gaps = 1/48 (2%) Frame = -1 Query: 463 ARIGDCS-DSCLTSTGSPLSPLGVGLQSAAIKKRQRPMFASGESLTWE 323 ARIGDCS +SCLTSTGSP+SP+GVG +A+IKKR RP+F +G+SL E Sbjct: 241 ARIGDCSVESCLTSTGSPVSPMGVGSHTASIKKRPRPIFGNGDSLPLE 288 >ref|XP_002300173.1| predicted protein [Populus trichocarpa] gi|222847431|gb|EEE84978.1| predicted protein [Populus trichocarpa] Length = 285 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/45 (68%), Positives = 39/45 (86%), Gaps = 1/45 (2%) Frame = -1 Query: 463 ARIGDCS-DSCLTSTGSPLSPLGVGLQSAAIKKRQRPMFASGESL 332 AR+GDCS +SCLTSTGSP+SP+GVG Q A+ KKR RP+F +G+SL Sbjct: 241 ARVGDCSVESCLTSTGSPVSPMGVGAQVASTKKRSRPVFGNGDSL 285 >emb|CCA29095.1| putative MYB transcription factor [Rosa rugosa] gi|327412625|emb|CCA29101.1| putative MYB transcription factor [Rosa rugosa] Length = 307 Score = 64.3 bits (155), Expect = 1e-08 Identities = 32/48 (66%), Positives = 40/48 (83%), Gaps = 1/48 (2%) Frame = -1 Query: 463 ARIGDCS-DSCLTSTGSPLSPLGVGLQSAAIKKRQRPMFASGESLTWE 323 ARIG+CS DSCLTSTGSP SP+G+ +AA+KKRQRP F++G+SL E Sbjct: 245 ARIGNCSVDSCLTSTGSPGSPMGMSSLAAAMKKRQRPFFSNGDSLPLE 292 >gb|ABK94861.1| unknown [Populus trichocarpa] Length = 309 Score = 64.3 bits (155), Expect = 1e-08 Identities = 31/48 (64%), Positives = 39/48 (81%), Gaps = 1/48 (2%) Frame = -1 Query: 463 ARIGDCS-DSCLTSTGSPLSPLGVGLQSAAIKKRQRPMFASGESLTWE 323 ARIGDCS +SCLTST SP+SP+GVG Q A+ KKR RP+ +G+SL +E Sbjct: 245 ARIGDCSVESCLTSTSSPVSPMGVGSQVASTKKRSRPVLGNGDSLPFE 292 >ref|XP_002268698.2| PREDICTED: uncharacterized protein LOC100250267 [Vitis vinifera] Length = 307 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/48 (62%), Positives = 36/48 (75%), Gaps = 1/48 (2%) Frame = -1 Query: 463 ARIGDCS-DSCLTSTGSPLSPLGVGLQSAAIKKRQRPMFASGESLTWE 323 ARIGDCS DSCLTS+GSP+SP+G + A +KKR RP+F G SL E Sbjct: 245 ARIGDCSVDSCLTSSGSPISPMGASSRGAVMKKRSRPLFTGGSSLALE 292