BLASTX nr result
ID: Coptis24_contig00018395
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00018395 (250 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285124.1| PREDICTED: chaperone protein dnaJ 49 isoform... 75 5e-12 emb|CAN60464.1| hypothetical protein VITISV_012494 [Vitis vinifera] 75 5e-12 ref|NP_196194.1| DNAJ heat shock N-terminal domain-containing pr... 75 7e-12 emb|CBI28183.3| unnamed protein product [Vitis vinifera] 74 1e-11 ref|XP_003527157.1| PREDICTED: chaperone protein dnaJ 49-like [G... 73 3e-11 >ref|XP_002285124.1| PREDICTED: chaperone protein dnaJ 49 isoform 1 [Vitis vinifera] gi|359484662|ref|XP_003633140.1| PREDICTED: chaperone protein dnaJ 49 isoform 2 [Vitis vinifera] gi|359484664|ref|XP_003633141.1| PREDICTED: chaperone protein dnaJ 49 isoform 3 [Vitis vinifera] Length = 357 Score = 75.1 bits (183), Expect = 5e-12 Identities = 33/43 (76%), Positives = 41/43 (95%) Frame = -1 Query: 130 MDGNKDEAVKCLKIGREAIEQGDRSRAVKFISKARRLDPNLEV 2 MDGNKDEA+KCLKIG++A+E GDR+RA+KF++KARRLDPNL V Sbjct: 1 MDGNKDEALKCLKIGKDALEAGDRARALKFVTKARRLDPNLPV 43 >emb|CAN60464.1| hypothetical protein VITISV_012494 [Vitis vinifera] Length = 321 Score = 75.1 bits (183), Expect = 5e-12 Identities = 33/43 (76%), Positives = 41/43 (95%) Frame = -1 Query: 130 MDGNKDEAVKCLKIGREAIEQGDRSRAVKFISKARRLDPNLEV 2 MDGNKDEA+KCLKIG++A+E GDR+RA+KF++KARRLDPNL V Sbjct: 1 MDGNKDEALKCLKIGKDALEAGDRARALKFVTKARRLDPNLPV 43 >ref|NP_196194.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] gi|9759100|dbj|BAB09669.1| DnaJ-like protein [Arabidopsis thaliana] gi|15810415|gb|AAL07095.1| putative DnaJ protein [Arabidopsis thaliana] gi|20258919|gb|AAM14153.1| putative DnaJ protein [Arabidopsis thaliana] gi|332003537|gb|AED90920.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] Length = 294 Score = 74.7 bits (182), Expect = 7e-12 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = -1 Query: 130 MDGNKDEAVKCLKIGREAIEQGDRSRAVKFISKARRLDPNLEV 2 MDGNKD+A+KCLKIG++AIE GDRSRA+KF+ KARRLDPNL + Sbjct: 1 MDGNKDDALKCLKIGKDAIEAGDRSRALKFLEKARRLDPNLPI 43 >emb|CBI28183.3| unnamed protein product [Vitis vinifera] Length = 226 Score = 73.9 bits (180), Expect = 1e-11 Identities = 32/41 (78%), Positives = 40/41 (97%) Frame = -1 Query: 130 MDGNKDEAVKCLKIGREAIEQGDRSRAVKFISKARRLDPNL 8 MDGNKDEA+KCLKIG++A+E GDR+RA+KF++KARRLDPNL Sbjct: 1 MDGNKDEALKCLKIGKDALEAGDRARALKFVTKARRLDPNL 41 >ref|XP_003527157.1| PREDICTED: chaperone protein dnaJ 49-like [Glycine max] Length = 364 Score = 72.8 bits (177), Expect = 3e-11 Identities = 32/43 (74%), Positives = 40/43 (93%) Frame = -1 Query: 130 MDGNKDEAVKCLKIGREAIEQGDRSRAVKFISKARRLDPNLEV 2 MDGNKD+A+KCL+IG+EA+E GDRSRA+KF++KARRLDP L V Sbjct: 1 MDGNKDDALKCLRIGKEAMESGDRSRALKFVTKARRLDPTLPV 43