BLASTX nr result
ID: Coptis24_contig00018366
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00018366 (263 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004157868.1| PREDICTED: uncharacterized protein LOC101231... 39 1e-06 >ref|XP_004157868.1| PREDICTED: uncharacterized protein LOC101231306 [Cucumis sativus] Length = 1768 Score = 39.3 bits (90), Expect(2) = 1e-06 Identities = 18/34 (52%), Positives = 24/34 (70%) Frame = +3 Query: 24 SQISEAVGFARSLFTRVGSLCPPKKLIDIQYRMH 125 SQ+ +AVG+ RSLF R+ L K L++ QYRMH Sbjct: 712 SQVCDAVGYGRSLFERLSLLGHSKHLLNTQYRMH 745 Score = 37.7 bits (86), Expect(2) = 1e-06 Identities = 14/41 (34%), Positives = 26/41 (63%) Frame = +2 Query: 134 SCFPSKRLFSGQLLNDPDDISRIRFNCQLPEHIYKAYSFID 256 SCFP+ + +S Q+L+ P ++ + C +P ++ YSFI+ Sbjct: 749 SCFPNSKFYSNQILDAPLVMAEVHKKCYIPSPMFGPYSFIN 789