BLASTX nr result
ID: Coptis24_contig00018235
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00018235 (325 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513534.1| Magnesium-chelatase subunit chlD, chloroplas... 95 5e-18 ref|XP_002274874.2| PREDICTED: magnesium-chelatase subunit chlD,... 94 2e-17 emb|CBI17197.3| unnamed protein product [Vitis vinifera] 94 2e-17 ref|XP_003563940.1| PREDICTED: magnesium-chelatase subunit chlD,... 91 1e-16 ref|XP_003517516.1| PREDICTED: magnesium-chelatase subunit chlD,... 91 1e-16 >ref|XP_002513534.1| Magnesium-chelatase subunit chlD, chloroplast precursor, putative [Ricinus communis] gi|223547442|gb|EEF48937.1| Magnesium-chelatase subunit chlD, chloroplast precursor, putative [Ricinus communis] Length = 760 Score = 95.1 bits (235), Expect = 5e-18 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = +3 Query: 3 LRGGCEGHRADLYAARVAKCLAALEGREKVNVDDLKKAVELVILPRSMI 149 LRGGC+GHRA+LYAARVAKCLAALEGREKVNVDDLKKAVELVILPRS+I Sbjct: 359 LRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVILPRSII 407 >ref|XP_002274874.2| PREDICTED: magnesium-chelatase subunit chlD, chloroplastic [Vitis vinifera] Length = 720 Score = 93.6 bits (231), Expect = 2e-17 Identities = 45/49 (91%), Positives = 48/49 (97%) Frame = +3 Query: 3 LRGGCEGHRADLYAARVAKCLAALEGREKVNVDDLKKAVELVILPRSMI 149 LRGGC+GHRA+LYAARVAKCL ALEGREKVNVDDLKKAVELVILPRS+I Sbjct: 316 LRGGCQGHRAELYAARVAKCLTALEGREKVNVDDLKKAVELVILPRSII 364 >emb|CBI17197.3| unnamed protein product [Vitis vinifera] Length = 605 Score = 93.6 bits (231), Expect = 2e-17 Identities = 45/49 (91%), Positives = 48/49 (97%) Frame = +3 Query: 3 LRGGCEGHRADLYAARVAKCLAALEGREKVNVDDLKKAVELVILPRSMI 149 LRGGC+GHRA+LYAARVAKCL ALEGREKVNVDDLKKAVELVILPRS+I Sbjct: 201 LRGGCQGHRAELYAARVAKCLTALEGREKVNVDDLKKAVELVILPRSII 249 >ref|XP_003563940.1| PREDICTED: magnesium-chelatase subunit chlD, chloroplastic-like [Brachypodium distachyon] Length = 758 Score = 90.5 bits (223), Expect = 1e-16 Identities = 43/49 (87%), Positives = 48/49 (97%) Frame = +3 Query: 3 LRGGCEGHRADLYAARVAKCLAALEGREKVNVDDLKKAVELVILPRSMI 149 +RGGC+GHRA+LYAARVAKCLAA+EGREKV VDDLKKAVELVILPRS+I Sbjct: 347 IRGGCQGHRAELYAARVAKCLAAMEGREKVYVDDLKKAVELVILPRSII 395 >ref|XP_003517516.1| PREDICTED: magnesium-chelatase subunit chlD, chloroplastic-like [Glycine max] Length = 750 Score = 90.5 bits (223), Expect = 1e-16 Identities = 44/49 (89%), Positives = 48/49 (97%) Frame = +3 Query: 3 LRGGCEGHRADLYAARVAKCLAALEGREKVNVDDLKKAVELVILPRSMI 149 LRGGC+GHRA+L+AARVAKCLAALEGREKV VDDLKKAVELVILPRS+I Sbjct: 346 LRGGCQGHRAELFAARVAKCLAALEGREKVYVDDLKKAVELVILPRSII 394