BLASTX nr result
ID: Coptis24_contig00018034
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00018034 (569 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001774563.1| putative histone deacetylase complex, SIN3 c... 65 6e-09 ref|XP_001776865.1| histone deacetylase complex, SIN3 component ... 65 6e-09 ref|XP_002267856.2| PREDICTED: paired amphipathic helix protein ... 65 8e-09 emb|CBI32068.3| unnamed protein product [Vitis vinifera] 65 8e-09 ref|XP_002314629.1| SIN3 component, histone deacetylase complex ... 65 8e-09 >ref|XP_001774563.1| putative histone deacetylase complex, SIN3 component [Physcomitrella patens subsp. patens] gi|162674118|gb|EDQ60631.1| putative histone deacetylase complex, SIN3 component [Physcomitrella patens subsp. patens] Length = 990 Score = 65.5 bits (158), Expect = 6e-09 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 234 TADVIAKIKVLFRGHQNLILGFNTFLPNGYEITLPLEGDK 115 TA VI ++K LF+GH+ LILGFNTFLP GYEITLPLE DK Sbjct: 43 TAGVITRVKDLFKGHRQLILGFNTFLPRGYEITLPLEEDK 82 >ref|XP_001776865.1| histone deacetylase complex, SIN3 component [Physcomitrella patens subsp. patens] gi|162671721|gb|EDQ58268.1| histone deacetylase complex, SIN3 component [Physcomitrella patens subsp. patens] Length = 1500 Score = 65.5 bits (158), Expect = 6e-09 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 234 TADVIAKIKVLFRGHQNLILGFNTFLPNGYEITLPLEGDK 115 TA VI ++K LF+GH+ LILGFNTFLP GYEITLPLE DK Sbjct: 83 TAGVITRVKDLFKGHRQLILGFNTFLPRGYEITLPLEEDK 122 >ref|XP_002267856.2| PREDICTED: paired amphipathic helix protein Sin3-like 4-like [Vitis vinifera] Length = 1421 Score = 65.1 bits (157), Expect = 8e-09 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = -3 Query: 234 TADVIAKIKVLFRGHQNLILGFNTFLPNGYEITLPLEGDK 115 TA VIA++K LF+GH++LILGFNTFLP GYEITLPLE ++ Sbjct: 80 TAGVIARVKELFKGHRDLILGFNTFLPKGYEITLPLEDEQ 119 >emb|CBI32068.3| unnamed protein product [Vitis vinifera] Length = 1445 Score = 65.1 bits (157), Expect = 8e-09 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = -3 Query: 234 TADVIAKIKVLFRGHQNLILGFNTFLPNGYEITLPLEGDK 115 TA VIA++K LF+GH++LILGFNTFLP GYEITLPLE ++ Sbjct: 80 TAGVIARVKELFKGHRDLILGFNTFLPKGYEITLPLEDEQ 119 >ref|XP_002314629.1| SIN3 component, histone deacetylase complex [Populus trichocarpa] gi|222863669|gb|EEF00800.1| SIN3 component, histone deacetylase complex [Populus trichocarpa] Length = 1385 Score = 65.1 bits (157), Expect = 8e-09 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = -3 Query: 234 TADVIAKIKVLFRGHQNLILGFNTFLPNGYEITLPLEGDK 115 TA VIA++K LF+GH++LILGFNTFLP GYEITLPLE ++ Sbjct: 54 TAGVIARVKELFKGHRDLILGFNTFLPKGYEITLPLEDEQ 93