BLASTX nr result
ID: Coptis24_contig00018031
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00018031 (411 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529521.1| cysteine-type endopeptidase, putative [Ricin... 56 3e-06 >ref|XP_002529521.1| cysteine-type endopeptidase, putative [Ricinus communis] gi|223531005|gb|EEF32859.1| cysteine-type endopeptidase, putative [Ricinus communis] Length = 644 Score = 55.8 bits (133), Expect = 3e-06 Identities = 34/87 (39%), Positives = 50/87 (57%), Gaps = 4/87 (4%) Frame = -2 Query: 401 SKKLIPTISKNDKVPSSPRIKFNILKSSDSKELRPXXXXXXXGYAGYHID----IKERKE 234 S+K IP++SK DKVPSSPR+KFNI +S SK + P + +++ +K+R Sbjct: 395 SRKDIPSMSKVDKVPSSPRVKFNIFGNSLSKRILPTGDGKAESHKSQNMEMNGSMKDRVY 454 Query: 233 MKKITKEMPSVTNVAHVNESLDALDPE 153 ++K K+MPS N N+S D E Sbjct: 455 VEKHDKDMPSTINGNGCNKSRKINDGE 481