BLASTX nr result
ID: Coptis24_contig00016521
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00016521 (334 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270810.2| PREDICTED: uncharacterized protein LOC100244... 55 5e-06 >ref|XP_002270810.2| PREDICTED: uncharacterized protein LOC100244219 [Vitis vinifera] gi|297737287|emb|CBI26488.3| unnamed protein product [Vitis vinifera] Length = 439 Score = 55.5 bits (132), Expect = 5e-06 Identities = 23/41 (56%), Positives = 30/41 (73%) Frame = -1 Query: 334 GNKLVKLIQSTLSMNIPPFNPKAGDFQSMYKNFVSSKHREL 212 G VKL+QSTL+ N+PPF PK GD + YK+F+S K +EL Sbjct: 393 GKDFVKLVQSTLTKNVPPFEPKGGDLEGKYKSFLSGKFKEL 433