BLASTX nr result
ID: Coptis24_contig00016514
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00016514 (535 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004138819.1| PREDICTED: uncharacterized protein LOC101219... 56 3e-06 >ref|XP_004138819.1| PREDICTED: uncharacterized protein LOC101219073 [Cucumis sativus] Length = 382 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/47 (55%), Positives = 37/47 (78%) Frame = +3 Query: 3 QTLLSKGLISKNSVGRALKLVENAFLERFVIRYQNEVPELLKLYQSK 143 Q L+SKGLI + S+G ALK+ E+ FLE+FV++Y +E P LL++YQ K Sbjct: 331 QHLISKGLIKRKSLGMALKISEHEFLEKFVMQYLSEDPHLLEMYQEK 377