BLASTX nr result
ID: Coptis24_contig00016493
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00016493 (376 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003551371.1| PREDICTED: uncharacterized protein LOC100781... 55 8e-06 >ref|XP_003551371.1| PREDICTED: uncharacterized protein LOC100781662 [Glycine max] Length = 541 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +3 Query: 270 ILVFSILEIAKKMKLKFTKAWLSFLRLSLPLDVYK 374 ILV S ++AKKMKLKFTK W+++LRL LP+DVYK Sbjct: 322 ILVLSAAKVAKKMKLKFTKEWIAYLRLPLPIDVYK 356