BLASTX nr result
ID: Coptis24_contig00016472
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00016472 (1011 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518872.1| ATP-dependent transporter, putative [Ricinus... 49 6e-06 >ref|XP_002518872.1| ATP-dependent transporter, putative [Ricinus communis] gi|223541859|gb|EEF43405.1| ATP-dependent transporter, putative [Ricinus communis] Length = 383 Score = 48.5 bits (114), Expect(2) = 6e-06 Identities = 28/57 (49%), Positives = 34/57 (59%), Gaps = 7/57 (12%) Frame = +1 Query: 676 LLDEPMDFLDLHAGKWCPA---K*AMTFLVASHARAILNTTYT----LHGQLMNPFE 825 LLDEP + LDLHA W + K TF+V SHAR LNT T LHGQ +N ++ Sbjct: 31 LLDEPTNHLDLHAVLWLESYLVKWPKTFIVVSHAREFLNTVVTDILHLHGQKLNAYK 87 Score = 28.5 bits (62), Expect(2) = 6e-06 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +3 Query: 810 YESF*DDIRKQLKNLQKVAESNERAKEQVVVFI 908 Y++F +Q+KN QK E+NE+A+ + FI Sbjct: 90 YDTFERTREEQVKNQQKALEANEKARAHMQSFI 122