BLASTX nr result
ID: Coptis24_contig00016190
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00016190 (263 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306035.1| predicted protein [Populus trichocarpa] gi|2... 72 6e-11 ref|XP_002305882.1| predicted protein [Populus trichocarpa] gi|2... 72 6e-11 ref|XP_002533531.1| nonsense-mediated mRNA decay protein, putati... 70 1e-10 ref|XP_004162315.1| PREDICTED: 60S ribosomal export protein NMD3... 67 2e-09 ref|XP_002265288.1| PREDICTED: 60S ribosomal export protein NMD3... 66 3e-09 >ref|XP_002306035.1| predicted protein [Populus trichocarpa] gi|222848999|gb|EEE86546.1| predicted protein [Populus trichocarpa] Length = 511 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +2 Query: 68 NLDDIELDKYKNLVLPDAILIKKSYEEKRLKKRGKPRSW*LCS 196 N +D+ELDKYKNLV+P+AIL+KKSYEEKR +KRGKPRSW L S Sbjct: 383 NSNDMELDKYKNLVIPEAILVKKSYEEKRQRKRGKPRSWKLKS 425 >ref|XP_002305882.1| predicted protein [Populus trichocarpa] gi|222848846|gb|EEE86393.1| predicted protein [Populus trichocarpa] Length = 511 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +2 Query: 68 NLDDIELDKYKNLVLPDAILIKKSYEEKRLKKRGKPRSW*LCS 196 N +D+ELDKYKNLV+P+AIL+KKSYEEKR +KRGKPRSW L S Sbjct: 383 NSNDMELDKYKNLVIPEAILVKKSYEEKRQRKRGKPRSWKLKS 425 >ref|XP_002533531.1| nonsense-mediated mRNA decay protein, putative [Ricinus communis] gi|223526598|gb|EEF28848.1| nonsense-mediated mRNA decay protein, putative [Ricinus communis] Length = 511 Score = 70.5 bits (171), Expect = 1e-10 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +2 Query: 68 NLDDIELDKYKNLVLPDAILIKKSYEEKRLKKRGKPRSW*LCS 196 N +DIELDKYK LVLP+AILIKKSYEEKR +KRGKPR+W L S Sbjct: 383 NSNDIELDKYKGLVLPEAILIKKSYEEKRQRKRGKPRAWKLKS 425 >ref|XP_004162315.1| PREDICTED: 60S ribosomal export protein NMD3-like [Cucumis sativus] Length = 505 Score = 66.6 bits (161), Expect = 2e-09 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +2 Query: 68 NLDDIELDKYKNLVLPDAILIKKSYEEKRLKKRGKPRSW*LCS 196 N +D+EL+KYK L LP+AILIKKSYEEKR +KRGKPRSW L S Sbjct: 382 NSNDMELEKYKGLELPEAILIKKSYEEKRQRKRGKPRSWKLKS 424 >ref|XP_002265288.1| PREDICTED: 60S ribosomal export protein NMD3-like [Vitis vinifera] Length = 510 Score = 66.2 bits (160), Expect = 3e-09 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +2 Query: 68 NLDDIELDKYKNLVLPDAILIKKSYEEKRLKKRGKPRSW*LCS 196 N +D+EL+KY+ VLP+AILIKKSYEEKR +KRGKPRSW L S Sbjct: 382 NSNDMELEKYRGFVLPEAILIKKSYEEKRQRKRGKPRSWKLKS 424