BLASTX nr result
ID: Coptis24_contig00016006
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00016006 (238 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002312864.1| predicted protein [Populus trichocarpa] gi|2... 74 2e-11 dbj|BAJ90403.1| predicted protein [Hordeum vulgare subsp. vulgar... 72 4e-11 ref|XP_003561396.1| PREDICTED: uncharacterized protein LOC100829... 72 5e-11 ref|XP_003601356.1| hypothetical protein MTR_3g079820 [Medicago ... 72 5e-11 ref|NP_001238276.1| uncharacterized protein LOC100305889 [Glycin... 72 5e-11 >ref|XP_002312864.1| predicted protein [Populus trichocarpa] gi|222849272|gb|EEE86819.1| predicted protein [Populus trichocarpa] Length = 129 Score = 73.6 bits (179), Expect = 2e-11 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +3 Query: 3 GDVGRIVARKPKDVWAVRLAIGTYLIDGKHFRPLDLDE 116 GDVGRIV+RKPKDVWAVRLAIGTYLIDGK+F+PL+L E Sbjct: 92 GDVGRIVSRKPKDVWAVRLAIGTYLIDGKYFKPLELSE 129 >dbj|BAJ90403.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326499692|dbj|BAJ86157.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 129 Score = 72.4 bits (176), Expect = 4e-11 Identities = 30/36 (83%), Positives = 36/36 (100%) Frame = +3 Query: 3 GDVGRIVARKPKDVWAVRLAIGTYLIDGKHFRPLDL 110 GDVGRI+ARKPKDVWAVRLA+GTYL+DGKHF+PL++ Sbjct: 81 GDVGRIIARKPKDVWAVRLAVGTYLLDGKHFKPLEV 116 >ref|XP_003561396.1| PREDICTED: uncharacterized protein LOC100829764 [Brachypodium distachyon] Length = 145 Score = 72.0 bits (175), Expect = 5e-11 Identities = 30/36 (83%), Positives = 36/36 (100%) Frame = +3 Query: 3 GDVGRIVARKPKDVWAVRLAIGTYLIDGKHFRPLDL 110 GDVGRI+AR+PKDVWAVRLA+GTYL+DGKHF+PLD+ Sbjct: 96 GDVGRIMARRPKDVWAVRLAVGTYLLDGKHFKPLDV 131 >ref|XP_003601356.1| hypothetical protein MTR_3g079820 [Medicago truncatula] gi|355490404|gb|AES71607.1| hypothetical protein MTR_3g079820 [Medicago truncatula] Length = 128 Score = 72.0 bits (175), Expect = 5e-11 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = +3 Query: 3 GDVGRIVARKPKDVWAVRLAIGTYLIDGKHFRPLDL 110 GDVGRIV+RKPKDVWAVRL+IGTYLIDGK+F+PLDL Sbjct: 89 GDVGRIVSRKPKDVWAVRLSIGTYLIDGKYFKPLDL 124 >ref|NP_001238276.1| uncharacterized protein LOC100305889 [Glycine max] gi|255626895|gb|ACU13792.1| unknown [Glycine max] Length = 128 Score = 72.0 bits (175), Expect = 5e-11 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +3 Query: 3 GDVGRIVARKPKDVWAVRLAIGTYLIDGKHFRPLDLDE 116 GDVGRIV+RKPKDVWAVRL IGTYL+DGK+F+PLDL E Sbjct: 89 GDVGRIVSRKPKDVWAVRLRIGTYLVDGKYFKPLDLAE 126