BLASTX nr result
ID: Coptis24_contig00015801
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00015801 (916 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313570.1| predicted protein [Populus trichocarpa] gi|2... 81 3e-13 ref|XP_002328143.1| predicted protein [Populus trichocarpa] gi|2... 81 3e-13 ref|NP_195533.2| SEC7-like guanine nucleotide exchange family pr... 80 5e-13 ref|XP_002866786.1| guanine nucleotide exchange family protein [... 80 5e-13 dbj|BAE99247.1| guanine nucleotide-exchange protein -like [Arabi... 80 5e-13 >ref|XP_002313570.1| predicted protein [Populus trichocarpa] gi|222849978|gb|EEE87525.1| predicted protein [Populus trichocarpa] Length = 1729 Score = 81.3 bits (199), Expect = 3e-13 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +2 Query: 2 PFVIVMKKSSSAEIRELIVRCVSQMVLSRVSNVKSGWKSVFMV 130 PFVIVM+KSSS EIRELIVRC+SQMVLSRVSNVKSGWKSVFMV Sbjct: 1144 PFVIVMQKSSSTEIRELIVRCISQMVLSRVSNVKSGWKSVFMV 1186 >ref|XP_002328143.1| predicted protein [Populus trichocarpa] gi|222837658|gb|EEE76023.1| predicted protein [Populus trichocarpa] Length = 1638 Score = 81.3 bits (199), Expect = 3e-13 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +2 Query: 2 PFVIVMKKSSSAEIRELIVRCVSQMVLSRVSNVKSGWKSVFMV 130 PFVIVM+KSSS EIRELIVRC+SQMVLSRVSNVKSGWKSVFMV Sbjct: 1053 PFVIVMQKSSSTEIRELIVRCISQMVLSRVSNVKSGWKSVFMV 1095 >ref|NP_195533.2| SEC7-like guanine nucleotide exchange family protein [Arabidopsis thaliana] gi|449061809|sp|F4JSZ5.1|BIG1_ARATH RecName: Full=Brefeldin A-inhibited guanine nucleotide-exchange protein 1; Short=BIG1; AltName: Full=ARF guanine-nucleotide exchange factor BIG1 gi|332661492|gb|AEE86892.1| SEC7-like guanine nucleotide exchange family protein [Arabidopsis thaliana] Length = 1687 Score = 80.5 bits (197), Expect = 5e-13 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +2 Query: 2 PFVIVMKKSSSAEIRELIVRCVSQMVLSRVSNVKSGWKSVFMV 130 PFVIVM+KSSSAEIRELIVRC+SQMVLSRVSNVKSGWKSVF V Sbjct: 1104 PFVIVMQKSSSAEIRELIVRCISQMVLSRVSNVKSGWKSVFKV 1146 >ref|XP_002866786.1| guanine nucleotide exchange family protein [Arabidopsis lyrata subsp. lyrata] gi|297312622|gb|EFH43045.1| guanine nucleotide exchange family protein [Arabidopsis lyrata subsp. lyrata] Length = 1694 Score = 80.5 bits (197), Expect = 5e-13 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +2 Query: 2 PFVIVMKKSSSAEIRELIVRCVSQMVLSRVSNVKSGWKSVFMV 130 PFVIVM+KSSSAEIRELIVRC+SQMVLSRVSNVKSGWKSVF V Sbjct: 1117 PFVIVMQKSSSAEIRELIVRCISQMVLSRVSNVKSGWKSVFKV 1159 >dbj|BAE99247.1| guanine nucleotide-exchange protein -like [Arabidopsis thaliana] Length = 791 Score = 80.5 bits (197), Expect = 5e-13 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +2 Query: 2 PFVIVMKKSSSAEIRELIVRCVSQMVLSRVSNVKSGWKSVFMV 130 PFVIVM+KSSSAEIRELIVRC+SQMVLSRVSNVKSGWKSVF V Sbjct: 208 PFVIVMQKSSSAEIRELIVRCISQMVLSRVSNVKSGWKSVFKV 250